(data stored in ACNUC9435 zone)

EMBL: CP000031.PHNK

CP000031.PHNK        Location/Qualifiers
FT   CDS_pept        478684..479454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="SPO0472"
FT                   /product="alkylphosphonate utilization protein PhnK"
FT                   /note="identified by similarity to SP:P16678"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93790"
FT                   /db_xref="GOA:Q5LW70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW70"
FT                   /protein_id="AAV93790.1"
FT                   /translation="MSPLLEVRGIEKRYGARIGCTNVSFDLYPGEVMGIVGESGSGKST
FT                   LLNCLAGHLVPDAGQVIFDTRHTGPVDTVTMSEPERRMLSRTDWAFVHQHARDGLRMSV
FT                   SAGGNIGERLMAVGDRHYGRIRASALDWLDRVEIDGARIDDRPTAFSGGMQQRLQIARN
FT                   LVTGPRLVFMDEPTGGLDVSVQARLLDLLRGLVRRMGLSAIIVTHDLAVVRLLADRLMV
FT                   MKDGRVVESGLTDQVLDDPQHGYTQLLVSSVLQV"
     atgagcccct tgttggaggt gcggggaatc gaaaagcgct atggtgcgcg gatcggctgc        60
     accaatgtga gtttcgatct ctaccccggc gaggtgatgg ggatcgtggg tgaaagcggc       120
     tcgggcaagt cgacgctgct caattgtctg gcgggtcatc tggtgcccga tgcggggcag       180
     gtgatctttg acacccgcca tacggggccg gtggatacgg tcaccatgtc ggaacccgag       240
     cggcggatgc tgtcgcgcac ggactgggcc tttgtgcatc agcatgcccg cgacgggctg       300
     cgcatgtcgg tctcggcggg cggcaatatc ggtgaacggc tgatggcggt gggggatcgg       360
     cattatggcc gcatccgcgc ctccgcgctc gattggctgg accgcgtcga gatcgacggc       420
     gcccggatcg acgaccggcc cacggctttt tccggcggca tgcagcagcg cttgcagatc       480
     gcgcgaaacc tggtgacagg tccccggctg gtgttcatgg acgaacccac cggcggcctc       540
     gacgtgagtg tacaggcgcg tcttctggac ctcttgcgcg gattggtgcg gcggatgggt       600
     ttgagcgcca tcatcgtcac ccacgatctg gcggtggtgc gcctgctggc cgaccggctg       660
     atggtgatga aggacgggcg cgtggtcgaa agcgggctga ccgatcaggt gctggacgat       720
     ccgcagcatg gctataccca actgctggtg tcgagtgtgt tgcaggtttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page