(data stored in ACNUC7421 zone)

EMBL: CP000031.PNCA

CP000031.PNCA        Location/Qualifiers
FT   CDS_pept        92595..93185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="SPO0093"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="identified by similarity to SP:P21369; match to
FT                   protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93423"
FT                   /db_xref="GOA:Q5LWN6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN6"
FT                   /protein_id="AAV93423.1"
FT                   /translation="MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQ
FT                   DWHPAGHSSFASSHPGQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILR
FT                   KGFRAAIDSYSGFFENDRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGF
FT                   AVEVRMQACRAIDLDGSLAAAIAAMKAGGIALT"
     atgcatggcc tgatcgtgat cgacgtccag aacgacttct gccccggcgg tgccctggcg        60
     gtgcccgaag gcgacgcggt ggtggcgccg atcaacgcca tgatgaagga tttcgacgcg       120
     gtggtcctga cgcaggattg gcacccggcg gggcattcct ctttcgcttc gtcccatccg       180
     ggccaagcac cgttcgagat gatcgagatg gcctatgggc cgcaggtgtt gtggcccgac       240
     cattgcgtgc agggcagccc cggcgctgcg tttcacccgg cgctgcggac cgatgccgat       300
     ttgatcctgc gcaaggggtt ccgcgccgcg atcgacagct attcgggctt cttcgaaaac       360
     gaccgcagca cgcccaccgg cctcgagggc tatttgcgca gccggggcat cacccgactg       420
     acgctggccg gactcgccac cgatttctgc gtgcagtatt cggcgctgga tgcggcgcgg       480
     ctgggctttg ccgtcgaggt gcggatgcag gcctgtcgcg ccatcgatct ggacgggtcg       540
     ctggcggcgg cgattgccgc gatgaaggcg ggcgggattg ctctgacctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page