(data stored in ACNUC7421 zone)

EMBL: CP000031.PTSN

CP000031.PTSN        Location/Qualifiers
FT   CDS_pept        complement(77195..77659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="SPO0077"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR01419"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93408"
FT                   /db_xref="GOA:Q5LWN4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN4"
FT                   /protein_id="AAV93408.1"
FT                   /translation="MELSSILKPNAVRVIGAASSKKRLFQEITDLAEATLKLDAQETLE
FT                   ALLERESLGPTGVGHGVALPHARVAGLDQVAGVFVLLEKPLDFGAVDRQPVDLAFALFA
FT                   PEDAGVEHLKALALVSRTLREQAVCTKLRANPDPTKLYAILTESHPLQAA"
     atggagcttt cgagcatcct caaaccaaac gcggtccgcg tcatcggtgc cgcatcgagc        60
     aagaaaagat tatttcagga aatcacggac ttggccgagg ccaccctgaa gctggacgct       120
     caggaaaccc tcgaggccct gctcgagcgt gaaagcctgg gcccgaccgg agtcggccat       180
     ggcgtcgcgc tgccgcatgc gcgcgtcgcg ggcctggatc aggtggcggg cgtgtttgtc       240
     ctgctggaaa agccgctgga tttcggcgct gtcgaccgtc agccggtcga cctggccttt       300
     gcgctgtttg cgcccgaaga cgccggtgtc gaacatctca aggcgctggc gctggtctcg       360
     cgcaccctgc gcgagcaggc ggtctgcacc aagctgcgcg ccaacccgga tccgaccaag       420
     ctctatgcca tcctgaccga atcacacccg cttcaagcgg cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page