(data stored in ACNUC7421 zone)

EMBL: CP000031.PYRB

CP000031.PYRB        Location/Qualifiers
FT   CDS_pept        complement(299165..300100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="SPO0287"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93605"
FT                   /db_xref="GOA:Q5LX75"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX75"
FT                   /protein_id="AAV93605.1"
FT                   /translation="MSFAHRHLLGIEQLSPADITAILDLAETYVALNRQSAKHSDVLSG
FT                   LTQINMFFENSTRTQASFELAGKRLGADVMNMSMQASSIKKGETLIDTAMTLNAMHPDL
FT                   LVVRHPHSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICG
FT                   DIAHSRVARSNLILLGKMENRIRLIGPPTLVPAQFAEFGAEVYDDMREGLKDVDVVMML
FT                   RLQRERMDGGFIPSEREYYHRYGLDREKLGLAKPDAIVMHPGPMNRGVEIDGTLADDIN
FT                   RSVIQEQVEMGVAVRMAAMELLARNLREAT"
     atgtcatttg cccaccgaca cctgcttggc atcgaacagc tgtctcccgc cgatatcacc        60
     gccatcctgg acctggccga gacctatgtg gccctgaacc ggcaatcggc caagcattcc       120
     gacgtgctgt cggggctgac ccagatcaac atgttctttg aaaactccac ccggacgcag       180
     gccagtttcg aactggcggg caagcggctg ggcgcggatg tgatgaacat gtcgatgcag       240
     gccagctcga tcaagaaggg cgagaccctg atcgacaccg cgatgacgct gaacgccatg       300
     catcccgacc tgctggtggt gcggcatccg cattcgggcg ctgtggacct gctggcgcag       360
     aaggtcaatt gcgcggtgct gaacgcgggc gacgggcggc acgaacatcc gacacaggcg       420
     ctcttggatg cgctgacgat ccgccgggcc aaggggcggc tgcaccggct gaacatcgcc       480
     atctgtggtg acatcgcgca cagccgcgtg gcccgctcga acctgatcct gctgggcaag       540
     atggaaaacc gcatccgcct gatcggcccg ccgacgctgg ttcccgccca gttcgccgag       600
     ttcggcgccg aggtctatga cgacatgcgc gaggggttga aggacgtcga tgtagtgatg       660
     atgctgcgcc ttcagcgcga gcggatggat ggcggtttca tcccgtccga acgcgagtat       720
     taccaccgtt acgggctgga tcgcgagaag ctggggctgg ccaagccaga tgccattgtg       780
     atgcatcccg gcccgatgaa ccggggggtc gagatcgacg gaacactggc cgacgatatc       840
     aaccgctcgg tgatccagga acaggtggaa atgggtgtcg ccgtgcgcat ggccgcgatg       900
     gagctgctgg cccgcaacct gcgagaggcc acatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page