(data stored in ACNUC7421 zone)

EMBL: CP000031.RADC

CP000031.RADC        Location/Qualifiers
FT   CDS_pept        53600..54274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="SPO0054"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by similarity to SP:P25531; match to
FT                   protein family HMM PF04002; match to protein family HMM
FT                   TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93385"
FT                   /db_xref="GOA:Q5LWK3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWK3"
FT                   /protein_id="AAV93385.1"
FT                   /translation="MPSYIRDHRKRLRERFMTGGAAALPDYELLELVLFRSIPRQDVKP
FT                   LARLLLDTFGDFNRVLTAPVERLAEVKGVGEAVITDLKILEASAHRMARARVMQRQVIS
FT                   SWDALLDYCHTTMAHRETEQFRVFYLDRKNVLIADEEQARGTVDHVPVYPREVAKRALE
FT                   LNASALILVHNHPSGDPTPSQSDIDMTARIRSACEALGLTLHDHLIIGKSVELSFRAEG
FT                   YL"
     ttgccatcct atattcggga tcatcgcaaa cgcctgcggg aacggttcat gacgggcgga        60
     gcggcggcgc tgccggatta cgaattgctg gaactggtgc tgtttcgatc aatcccgagg       120
     caagacgtca agccgctggc gcggctgctg ctggatacgt ttggtgattt caaccgggtg       180
     ctgaccgccc cggtggaacg gctggccgag gtcaaaggcg tgggcgaggc ggtgatcacc       240
     gacctcaaga tacttgaggc cagcgcccac cggatggccc gcgcacgggt gatgcagcgg       300
     caggtgattt ccagctggga cgcgctgctg gattattgcc acaccaccat ggcgcatcgc       360
     gagaccgaac agttccgggt cttttacctc gaccgcaaga acgtgctgat cgcggatgag       420
     gaacaggcgc gcggcacggt cgatcacgtg ccggtctatc cgcgcgaggt ggccaagcgg       480
     gcgctggagc tgaacgcctc ggcgctgatc ctggtgcata atcacccttc gggggatccg       540
     accccgtcac aatcggatat cgacatgacg gcgcggatcc gttccgcgtg tgaggcgctg       600
     gggcttacgt tgcatgacca tctgatcatc ggcaaatcgg tcgagctgag ctttcgcgcc       660
     gagggatatc tttag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page