(data stored in ACNUC7421 zone)

EMBL: CP000031.RECF

CP000031.RECF        Location/Qualifiers
FT   CDS_pept        167177..168277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SPO0151"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P13456; match to
FT                   protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93479"
FT                   /db_xref="GOA:Q5LWV2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV2"
FT                   /protein_id="AAV93479.1"
FT                   /translation="MALALTAITISHFRSHRLLRLSLDERPVAIHGPNGAGKTNILEAV
FT                   SMFSPGRGMRRASAAEMTRRPEVLGWKLSAELVAGHQRHEIETWSEGGAARQVRIDDKA
FT                   ASQVALGRLVRMVWLVPSMDRLWIEGPEGRRRFLDRMTMSFEPDHAEAVLVYEKAMRER
FT                   NRLLREQVRDAHWYLALETQMAAAGHRIHAARQSTLTALAAAQTQAETSFPTAELELIQ
FT                   TEGALPESEGDLREALAESRFRDLAAGRTLVGPHRSDLYGVYAAKGVPASDCSTGEQKA
FT                   LLVSLILANARALARQVGAPPVLLLDEIAAHLDAGRRAALYDEICALGAQAWMTGTGPE
FT                   LFSELGARAQTIALCERDGQSEVVET"
     atggcactgg ccctgaccgc aatcacgatc tcgcatttcc ggtcgcaccg gttgctgcgg        60
     ctcagcctgg acgagcggcc cgtggcaatc catgggccca acggggcggg caagaccaac       120
     atccttgagg cggtctcgat gttctcgccg gggcgtggca tgcgccgggc cagcgcggcc       180
     gagatgaccc ggcgccccga ggtgctgggt tggaagctga gcgccgagct tgtcgcgggg       240
     catcaacgcc acgagatcga aacctggtcc gagggcggcg cggcgcggca ggtgcggatc       300
     gacgacaagg cggccagcca ggtggcgctg gggcggttgg tgcggatggt ctggctggta       360
     ccctcgatgg accggctgtg gatcgagggg cccgaggggc ggcggcggtt tctcgaccgg       420
     atgaccatga gtttcgagcc cgatcatgcc gaggcggttc tggtctatga aaaggccatg       480
     cgcgagcgca accgcctgct gcgcgaacag gtgcgcgatg cccattggta tctggcactg       540
     gaaacccaga tggcagccgc gggacaccgg attcatgccg cgcgccagag caccctgacc       600
     gcgctggccg ctgcacagac ccaggccgaa accagctttc ccaccgccga gctggagttg       660
     atccagaccg agggcgccct gcccgaaagc gagggtgacc tgcgcgaggc gctggccgag       720
     agccggtttc gcgatctggc cgcggggcgg acattggtgg ggccgcatcg cagcgacctg       780
     tacggtgtct atgccgccaa gggcgtgccc gccagcgact gttcgaccgg tgagcagaag       840
     gcgttgctgg tctcgctgat cctggccaat gcgcgcgcgc tggcccgaca ggtgggggcg       900
     ccgccggtgc tgcttttgga cgagatcgcg gcgcatctgg atgcggggcg ccgcgcggcg       960
     ctttatgacg agatctgtgc gctgggcgcg caggcctgga tgacgggcac cgggcctgaa      1020
     ctgttttccg aactcggtgc tcgggcgcaa accatcgccc tgtgcgagcg cgatggtcaa      1080
     tcagaggtgg tagaaacatg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page