(data stored in ACNUC7421 zone)

EMBL: CP000031.RECQ

CP000031.RECQ        Location/Qualifiers
FT   CDS_pept        complement(110244..112283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SPO0107"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93438"
FT                   /db_xref="GOA:Q5LWQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ8"
FT                   /protein_id="AAV93438.1"
FT                   /translation="MFDAAPLLRDVFGFDAFRPGQEEIAQAVAEGENVLAIMPTGGGKS
FT                   LCFQLPALMREGVTVVISPLIALMRDQVRSLQEAGVEAGALTSGNTPEETEAVWQALEA
FT                   GRLKLLYMAPERLASGAAMGMLRRIGVSLIAVDEAHCVSQWGHDFRPDYLRIGELRRAL
FT                   GVPLAAFTATADAETQAEIVAKLFDGEEPRSFLRGFDRPNIHLAFAAKDSPRRQILDFA
FT                   GARRGQSGIVYCGTRAKTETLAQALREDGHSACHYHGGMEAEDRRIVETRFAREDGLIV
FT                   VATVAFGMGIDKPDIRWVAHADLPKSIEAYYQEIGRAGRDGGPAETLTLFGPDDIRLRR
FT                   SQIDEGLAPPERRAADHARLNALLGLAEAMTCRRQTLLGYFGETEITCGKCDLCDSPAE
FT                   RFDGTTAVRMALSAMLRTEEWFGATHLIDILLGNQTDKIRDRRHDQLPTYGVGTEWNRA
FT                   QWQAIFRQMMGRDLVRPDPERHGALRMTEAALPILRGEAGIELRKDTVSKAARRPAVKA
FT                   MVNDEDAPLLSALKAKRRALAEAARVPAYVIFPDRTLIEMAEKRPASLDQMARIGGIGA
FT                   KKLERYGAMFLEVVSGAAEMLHPARRKLAGRQTGNIYDRLLAVQADLARGPDGIDKPLS
FT                   CSASQLAKVAQMRPDDRSGLEALLGDRRWERFGEAFLDVLGQTT"
     atgttcgacg ccgcaccgct gttgcgagat gtgtttggat tcgacgcctt ccgccccggg        60
     caggaggaga tcgcgcaggc cgtggccgag ggcgagaacg tgctggcgat catgccgacg       120
     gggggcggca agtcgctgtg tttccaactg ccggcgctga tgcgcgaggg ggtgacggtg       180
     gtgatctcgc cgctgatcgc cctgatgcgc gaccaggtgc gcagcctgca agaggcgggt       240
     gtcgaggcgg gggcgctgac ctcgggcaac acacccgagg agaccgaggc ggtctggcag       300
     gcgctggagg cggggcggct gaagctgctt tacatggccc ccgaacggct cgcatcgggc       360
     gcggcgatgg ggatgctgcg gcggatcggg gtcagcctga tcgcggtgga cgaggctcat       420
     tgcgtcagcc agtggggcca tgattttcgc cccgattacc tgcgtatcgg cgagctgcgc       480
     agggcgctgg gcgtgccgct ggccgccttt accgccacgg cggatgccga gacccaggcc       540
     gagatcgttg cgaaactgtt cgatggcgag gaaccgcgca gtttcctgcg cgggttcgac       600
     cggcccaata tccacctggc ctttgccgcc aaggacagcc cgcgccgcca gatcctggat       660
     ttcgcgggcg cccggcgcgg ccagtcgggc atcgtctatt gcggcacccg ggccaagacc       720
     gagacgctgg cgcaggccct gcgcgaggac ggccacagcg cctgtcacta tcacggcggc       780
     atggaggccg aggaccgccg catcgtcgag acccgctttg cccgcgagga cgggctgatc       840
     gtggtggcga cggtggcctt tggcatgggt atcgacaagc ccgatatccg ctgggtcgcc       900
     catgccgatc tgccgaaatc catcgaggcc tattatcagg agatcggccg tgcgggccgt       960
     gatggcgggc cggccgagac actgaccctg ttcggccccg acgacatccg cctgcgccgc      1020
     agccagatcg acgaaggcct ggccccgccc gagcgccgcg ccgccgatca tgcccggttg      1080
     aacgcgcttc tgggtctggc cgaggcgatg acctgccgtc gacagaccct gctgggttat      1140
     tttggcgaga ccgagatcac ctgcggcaaa tgcgatctgt gcgacagccc ggcggaacgg      1200
     ttcgatggca caaccgcagt gcgcatggcc ttgtcggcga tgctgcggac cgaggaatgg      1260
     ttcggcgcga cccatctgat cgacatcctg ctgggcaacc agaccgacaa gatccgcgac      1320
     cgccgccatg accagttgcc cacctatggg gtcggcaccg aatggaaccg cgcccagtgg      1380
     caggcgatct ttcgtcagat gatgggccgc gacctggtgc gcccagatcc cgaacgccac      1440
     ggcgcgctgc ggatgaccga ggcggcgctg ccgatcctgc gcggcgaggc cgggatcgag      1500
     ttgcgcaagg atacggtgag caaggcggcg cggcgtccgg cggtcaaggc catggtcaat      1560
     gacgaggacg cgccgctgct gtccgcgctc aaggccaagc gccgggcgct ggccgaggcg      1620
     gcacgggtcc cggcctatgt gatctttccc gaccgcacct tgatcgaaat ggccgagaag      1680
     cgccccgcat cgctggacca gatggcccgc atcggcggca tcggcgcaaa gaagttggag      1740
     cgttacggcg ccatgtttct ggaggtggtg agcggtgctg ccgagatgct gcaccccgcc      1800
     cgccgcaagc tggccgggcg gcagaccggc aacatctatg accggctgtt ggctgtgcag      1860
     gccgatctgg cgcgcggccc tgacggcatc gacaaaccgc tcagctgttc ggcgtcgcaa      1920
     ctggccaagg tggcgcaaat gcgccccgac gatcggagcg gacttgaggc gctgttgggt      1980
     gatcgacgct gggaacgttt tggtgaggcc tttctggacg tgctgggcca gacgacctag      2040
//

If you have problems or comments...

PBIL Back to PBIL home page