(data stored in ACNUC9435 zone)

EMBL: CP000031.RLUC

CP000031.RLUC        Location/Qualifiers
FT   CDS_pept        512820..513863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="SPO0516"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by similarity to SP:P23851"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93833"
FT                   /db_xref="GOA:Q5LW27"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW27"
FT                   /protein_id="AAV93833.1"
FT                   /translation="MSGVQMITVGEGDGDQRLDRWFRRMFPHVGQGRIEKMCRKGELRV
FT                   DGARAKPATRLEVGQQVRIPPLPAPGERPEPVKSRVSDSDAKLIRACVLHRDDDIIVLN
FT                   KPAGLAVQGGSGQTRHVDGLSEALRFGNDENPRLVHRLDKDTSGVLVLARTREAAARLT
FT                   AAFRHRNTRKIYWALVAGVPTPYLGEIKTGLVKAGGHGARGEGEKMNVVHLSELDATPG
FT                   AKRAHTYYATLYRVAGRASWVAMEPVTGRTHQLRAHMAGIGHPIIGDGKYGGSGQENLG
FT                   DGWGAQLGGIISKKLHLHARSLSFEHPSTRKKVTFTAPLPEHMRESWDTFGWTEDLAAE
FT                   DPFEELM"
     atgagcggcg tacagatgat caccgtgggt gagggggacg gcgaccagcg gcttgaccgc        60
     tggtttcgcc ggatgttccc gcatgtgggg caggggcgca tcgagaagat gtgccgcaag       120
     ggcgagctgc gcgtcgacgg ggcgcgggcc aagcccgcga cccggctcga agtgggccag       180
     caggtccgta tcccgccgct gcccgcaccc ggtgaacggc cagagccggt gaaatcgcgt       240
     gtctcggaca gtgatgccaa attgatccgc gcctgtgtcc tgcatcgcga cgacgatatc       300
     atcgtgctga acaagcccgc cgggctggcg gtgcaggggg gcagcggcca gacccgccat       360
     gtggatggcc tgtccgaggc gctacgcttt ggcaatgacg agaacccgcg cctggtgcac       420
     cggctggaca aggatacctc gggtgtgctg gtgctggcgc gcacccgcga ggcggcggcg       480
     cgtctgacag cggccttccg ccaccgcaac acgcgcaaga tctattgggc attggtggct       540
     ggggttccga cgccctatct gggcgagatc aagaccgggc tggtcaaggc cggtggtcac       600
     ggtgcccggg gcgagggcga gaagatgaac gtggtgcatc tgagcgagct tgacgcgacc       660
     cccggcgcca agcgggcgca tacctattat gccacgcttt accgggtggc ggggcgcgcg       720
     tcctgggtgg cgatggagcc ggtcaccggc cgcacccacc agctgcgcgc gcatatggcc       780
     gggatcgggc atccgatcat cggcgacggc aaatacggcg gctcggggca ggaaaacctg       840
     ggcgatggat ggggtgcgca actgggcggc atcatcagca agaaactgca tctgcatgcg       900
     cgcagcctga gctttgaaca tccttcgacc cgcaagaagg tcacctttac cgcgcccttg       960
     cccgagcata tgcgcgagag ctgggacacc ttcggctgga ccgaggatct ggcggcggag      1020
     gatccgttcg aggagctgat gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page