(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLB

CP000031.RPLB        Location/Qualifiers
FT   CDS_pept        487568..488410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPO0484"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:P02387"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93801"
FT                   /db_xref="GOA:Q5LW59"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW59"
FT                   /protein_id="AAV93801.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNN
FT                   TGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALIKYEDGEQAYI
FT                   LAPQRLAVGDKVVASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGIRPSVRG
FT                   VAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGTRTRNKNKASQKLIIRSRHAKKKGR"
     atggcactca agtcgtataa gccgacgacg ccgggccagc gcgggctggt gctgatcgac        60
     cgttcggagc tttggaaagg acgtccggtc aagtctctca ctgagggtct gaccaaatcg       120
     ggcggccgga acaacaccgg acggatcacc tcgcgtcgcc gcggtggtgg ggcaaaacgc       180
     ctctaccgga tcgttgactt caaacggaac aaattcgatg tggcggccac cgtcgagcgg       240
     atcgagtacg acccgaaccg gaccgcattc atcgcactga tcaaatacga agacggtgag       300
     caggcctata tcctggcccc gcagcgtctg gcggtcggtg acaaggtcgt ggcatccgcc       360
     aaggccgaca tcaagccggg caacgcgatg cctttctcgg gcatgccgat cggtaccatc       420
     gtgcacaaca tcgagatgaa gcccggcaag ggcggtcaga tcgcacgtgc cgccggcacc       480
     tacgcccagt tcgtgggccg tgatggcggc tatgctcaga tccgtctgag ctcgggcgaa       540
     ctgcgcatgg tgcgtcagga atgcatggcc accgtcggtg ccgtgtccaa ccccgacaac       600
     agcaaccaga actacggcaa ggccggccgc atgcggcaca agggcatccg cccgtcggtt       660
     cgcggtgtcg caatgaaccc gatcgaccac ccccatggtg gtggtgaggg tcgcacctcg       720
     ggtggccgta cgccggtgac cccgtggggc aaggacacca agggtacccg tacccgcaac       780
     aagaacaaag cgtcgcaaaa gctgatcatt cgctcgcgtc acgccaagaa gaaagggcgt       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page