(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLF

CP000031.RPLF        Location/Qualifiers
FT   CDS_pept        499197..499730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SPO0500"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by similarity to SP:P02391"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93817"
FT                   /db_xref="GOA:Q5LW43"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW43"
FT                   /protein_id="AAV93817.1"
FT                   /translation="MSRIGKKPVELPSGVSAAVSGQTIEVKGPKGARSFTATDDVTITV
FT                   DGNVVSITPRGMSKRARQQWGMSRTMVANLVAGVTEGFKKELEITGVGYRANAQGNTLK
FT                   LNLGYSHDVDFTVPAGVTVSTPKQTEIVVEGIDQQQVGEVAAKIREWRSPEPYKGKGIR
FT                   YKGEFIFRKDGKKK"
     atgtctcgta ttggtaagaa accggtcgag ctgcccagtg gcgtttccgc cgctgtgtcg        60
     ggccagacca tcgaagtgaa gggccccaag ggtgcccgca gcttcaccgc caccgacgac       120
     gtgaccatca ccgtcgacgg caatgtggtg agcatcaccc cccgtggcat gtccaagcgg       180
     gcacgccagc agtggggcat gtcgcgcacc atggtggcga acctcgtcgc aggcgtgacc       240
     gaaggcttca agaaagagct ggagatcacc ggtgtgggtt accgcgccaa cgcccagggc       300
     aacacgctca agctgaacct cggttacagc cacgatgtcg acttcaccgt tccggcgggc       360
     gtcaccgtga gcacgccgaa gcagaccgag atcgttgtcg aaggcatcga ccagcaacag       420
     gttggtgaag tggctgcgaa aatccgcgag tggcgttcgc ccgagccgta caaaggcaag       480
     ggtatccgct acaagggcga gttcatcttc cgcaaagacg gcaagaagaa gtaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page