(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLN

CP000031.RPLN        Location/Qualifiers
FT   CDS_pept        497221..497589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SPO0495"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by similarity to SP:P02411"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93812"
FT                   /db_xref="GOA:Q5LW48"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW48"
FT                   /protein_id="AAV93812.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTAIRFDRNAAVILNNNNEPVGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
     atgatccaga tgcaaaccaa tctggatgtc gctgacaact ccggcgctcg ccgagttcag        60
     tgcatcaagg ttctgggtgg ttccaagcgt aaatacgcct ccgtcggcga catcattgtc       120
     gtctcggtga aggaagccat cccgcgcggc cgcgtgaaga aaggtgacgt ccgcaaggcc       180
     gtcgtcgtgc gcaccgccaa agaagtccgt cgcgaagacg gcaccgcgat ccgcttcgat       240
     cgcaacgccg ccgtcatcct gaacaacaac aacgagccgg tcggtacccg tatctttggc       300
     ccggttgttc gtgaactgcg cgcgaagaac ttcatgaaga tcatctcgct ggctccggag       360
     gtgctgtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page