(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLP

CP000031.RPLP        Location/Qualifiers
FT   CDS_pept        489796..490209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPO0488"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by similarity to SP:P02414"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93805"
FT                   /db_xref="GOA:Q5LW55"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW55"
FT                   /protein_id="AAV93805.1"
FT                   /translation="MLQPKRTKFRKMFKGRIHGLAKGGSDLNFGTYGLKALEPERVTAR
FT                   QIEAARRAMTRHMKRQGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMF
FT                   EIDGVNDEIAREALRLAAMKLPIKTRVVVREDW"
     atgctgcaac caaagcgcac taaattccgc aagatgttca agggccgtat ccacggtctg        60
     gcaaaaggcg gaagcgacct gaacttcgga acctatggcc tcaaggcgct ggagcccgag       120
     cgggttaccg cccgccagat cgaagccgcc cgtcgtgcca tgacgcgtca catgaaacgt       180
     cagggccgcg tctggatccg gatcttcccg gatacgccgg tcacctcgaa gccgaccgaa       240
     gtccgtatgg gtaaaggtaa gggttcggtg gattactggg cctgcaaggt caagcccggc       300
     cgtgtgatgt tcgagatcga tggcgtcaat gacgaaatcg cccgcgaggc cctgcgcctg       360
     gccgcgatga agctgccgat caagacccgc gtcgtggtcc gcgaagactg gtaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page