(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLQ

CP000031.RPLQ        Location/Qualifiers
FT   CDS_pept        508954..509376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPO0512"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P02416"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93829"
FT                   /db_xref="GOA:Q5LW31"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW31"
FT                   /protein_id="AAV93829.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIVEKLITLGKRGDLHARRQAAAQLKEDKDVAKLFDVLAERYKDRQGGYVRILKAGFRY
FT                   GDMAPMAIIEFVDRDVDAKGAADKARLAEEEAAAEE"
     atgcgtcacg cacgtggtta ccgccgcctc aaccgcacac acgaacaccg caaggccctg        60
     tttgcgaaca tggccggctc gctgatcgag cacgaacaga tcaagaccac cctgcccaag       120
     gccaaggaac tgcgtccgat cgtcgaaaag ctgatcacgc tgggcaagcg cggtgacctg       180
     cacgcgcgcc gtcaggccgc ggcgcagctg aaagaggaca aggacgtcgc caagctgttc       240
     gacgttctgg ccgagcgcta caaggatcgt cagggcggtt acgtccgcat cctgaaggcc       300
     ggcttccgct atggcgacat ggcgccgatg gcgatcatcg aattcgtcga tcgcgacgtc       360
     gatgccaagg gtgccgccga caaggcgcgc ctggccgaag aagaggctgc cgccgaagaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page