(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLV

CP000031.RPLV        Location/Qualifiers
FT   CDS_pept        488696..489076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPO0486"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by similarity to SP:P02423"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93803"
FT                   /db_xref="GOA:Q5LW57"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW57"
FT                   /protein_id="AAV93803.1"
FT                   /translation="MGKEKNPRRVAENEAMAKLRMLRTSPQKLNLVAAMIRGKKVGQAL
FT                   TDLTFSNKRIAQDVKKCLQSAIANAENNHNLDVDELIVAEAWVGKNLVMKRGRPRARGR
FT                   FGKIMKPFSELTITVRQVEEQA"
     atgggcaagg aaaagaaccc ccgccgcgtg gccgaaaacg aagcaatggc aaaactgcgc        60
     atgcttcgca ccagcccgca gaaactgaac ctggttgcag cgatgatccg cggcaagaaa       120
     gttggacagg ccctgaccga cctgactttc tcgaacaagc ggatcgcgca ggacgtgaag       180
     aaatgccttc agtccgccat cgccaacgcc gaaaacaacc acaacctgga cgtggacgag       240
     ctgatcgttg cggaagcatg ggttggcaag aacctggtca tgaaacgcgg ccgtccgcgg       300
     gctcgtggcc ggttcggcaa gatcatgaag ccgttctcgg agctcaccat cacggtgcgt       360
     caagttgagg agcaagccta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page