(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLX

CP000031.RPLX        Location/Qualifiers
FT   CDS_pept        497592..497903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPO0496"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to SP:P12876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93813"
FT                   /db_xref="GOA:Q5LW47"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW47"
FT                   /protein_id="AAV93813.1"
FT                   /translation="MAAKLRKGDKVVVLAGKDKGKEGTITSVDPKAGKAVVDGVNIAIR
FT                   HTRQTQTSQGGRLPKALPIDLSNLALLDKNGKATRVGFRMEGDKKVRFAKTTGDVIDA"
     atggctgcca aactccgcaa aggcgacaag gtcgtcgtgc tggccggcaa ggacaagggc        60
     aaagagggga ctatcacctc ggttgacccg aaagccggca aggctgttgt cgacggcgtg       120
     aacatcgcca tccgtcacac ccgccagacc caaacctcgc aaggcggccg cctgcccaag       180
     gcgctgccga tcgacctcag caacctggcg ctgctggaca agaacggcaa ggcaacccgc       240
     gtcggcttcc gcatggaagg tgacaagaag gtccgctttg ccaagaccac gggggacgtg       300
     atcgatgctt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page