(data stored in ACNUC9435 zone)

EMBL: CP000031.RPMD

CP000031.RPMD        Location/Qualifiers
FT   CDS_pept        500799..500987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPO0503"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to SP:Q9Z9J6"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93820"
FT                   /db_xref="GOA:Q5LW40"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW40"
FT                   /protein_id="AAV93820.1"
FT                   /translation="MAKTIVVKQIGSPIRRPADQRATLVGLGLNKMHKTRELEDTPSVR
FT                   GMIRKIPHLVEIIEERG"
     atggcaaaaa ccatcgtcgt caagcagatc ggttcgccga tccgccgccc cgctgaccag        60
     cgcgcaaccc tggttggtct gggtctgaac aagatgcaca agacccgcga gctggaggat       120
     accccctcgg tccgcggcat gatccgcaag atcccgcatc tggtcgagat catcgaagag       180
     cgcggctaa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page