(data stored in ACNUC7421 zone)

EMBL: CP000031.RPMH

CP000031.RPMH        Location/Qualifiers
FT   CDS_pept        complement(533296..533445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SPO0538"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93855"
FT                   /db_xref="GOA:Q5LW05"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW05"
FT                   /protein_id="AAV93855.1"
FT                   /translation="MEYGAMKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRK
FT                   ELSA"
     ttggagtacg gagcgatgaa acgcacctat cagccttcga acctggttcg caaacgccgc        60
     cacggctttc gtgcgcgcat ggccaccaag gccggccgca agatcctgaa cgcacgccgc       120
     gcgcgtggcc gcaaggaact cagcgcctaa                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page