(data stored in ACNUC9435 zone)

EMBL: CP000031.RPOH-1

CP000031.RPOH-1      Location/Qualifiers
FT   CDS_pept        418384..419262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH-1"
FT                   /locus_tag="SPO0406"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P48194; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93724"
FT                   /db_xref="GOA:Q5LWD6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD6"
FT                   /protein_id="AAV93724.1"
FT                   /translation="MALNDPQDKRMSRQAMKAELLDAETELALAYAWRDHRDEAALHRL
FT                   ITAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMKAADKFDPDRGVRFSTYAVWWIKAS
FT                   IQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEREAATDGLALDRHQLHQMIASEIG
FT                   VPLRDVEMMEGRLSGSDFSLNATQASDEEGREWIEALEDESEQAAELVAHRHDTEQLRD
FT                   WLIEAMQALNERERFIVRERKLRDEPRTLESLGDELGLSKERVRQLEAAAFAKMRKSLE
FT                   ARSREVQHFLV"
     atggcactga acgacccgca ggacaaacgc atgtcccgac aggcgatgaa ggccgaactg        60
     ctcgatgccg agaccgagct ggccctggcc tatgcctggc gcgaccaccg cgacgaggcc       120
     gccttgcacc gcctgatcac cgcctatatg cggctggcga tctcgatggc ggccaagttc       180
     aaacgctatg gcgccccgat gaacgacctg atccaggagg ccggtctggg cctgatgaag       240
     gccgccgaca agttcgaccc ggatcggggc gtgcggtttt cgacctatgc ggtctggtgg       300
     atcaaggcca gcatccagga ctatgtgatg cgcaactggt cgatggtgcg gacaggctcg       360
     acctcaagcc agaaatcgct gtttttcaac atgcgccggg tgcaggcccg gctggagcgc       420
     gaggccgcca ccgacgggct ggcgctggac cggcatcagc tgcaccagat gatcgcctcg       480
     gaaatcgggg tgccgctgcg cgatgtggag atgatggagg gccggctttc gggctcggat       540
     ttctcgctga acgcgaccca ggcctcggac gaggaggggc gcgaatggat cgaggcgctt       600
     gaggacgaga gcgagcaggc cgccgaactg gtggcccacc ggcacgatac cgaacagctg       660
     cgcgactggc tgatcgaggc gatgcaggcg ctgaacgagc gcgagcgctt catcgtgcgc       720
     gagcgcaagc tgcgtgacga gccgcgcacg ctggaaagcc tgggcgatga actggggctg       780
     agcaaggagc gggtgcggca gttggaagcg gcggcctttg ccaagatgcg caagagcctt       840
     gaagcgcgct cgcgcgaggt gcaacacttc ctggtatga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page