(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSC

CP000031.RPSC        Location/Qualifiers
FT   CDS_pept        489076..489783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPO0487"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to SP:P02352"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93804"
FT                   /db_xref="GOA:Q5LW56"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW56"
FT                   /protein_id="AAV93804.1"
FT                   /translation="MGHKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLAIREFIKE
FT                   ECKQAGVARVIIERPHKKCRVTIHTARPGVIIGKKGADIETLRKKLANMTDSELHLNIV
FT                   EVRKPEMDAQLVAESIAQQLERRVSFRRAMKRAVQNSMRMGALGIRVNVAGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYALAEASTPYGIIGIKVWIFKGEILEHDPQARDRKAQEL
FT                   QDGPAPRGAGGRR"
     atgggacata aagtcaatcc gatcggcatg cgtcttcagg tcaatcgcac ctgggacagc        60
     cgctggtacg cagataccaa ggactatggc aatctgctgc ttgaagacct cgcaatccgc       120
     gaattcatca aggaagagtg caagcaggct ggcgttgccc gtgtgatcat cgagcgtccg       180
     cacaagaagt gccgcgtgac gatccacacc gcgcgtccgg gcgtgatcat cggcaaaaaa       240
     ggcgccgata tcgagaccct gcgcaagaag ctggcgaaca tgaccgacag cgaactgcac       300
     ctgaacatcg tcgaagtgcg caagcccgag atggatgctc agctggtcgc cgagtcgatc       360
     gcacagcagc tggaacgccg cgtgtccttc cgccgtgcga tgaagcgcgc ggtgcaaaac       420
     tcgatgcgga tgggtgccct gggcatccgt gtgaacgtcg ccggccgtct gggcggtgcc       480
     gagatcgcac ggaccgagtg gtatcgcgag ggccgtgtgc ccctgcacac cctgcgtgcc       540
     gacatcgatt atgctctggc cgaggcctcg accccttacg ggatcatcgg gatcaaggtc       600
     tggatcttca aaggcgagat cctcgagcat gatccgcagg cgcgtgaccg caaggcacag       660
     gaactccagg acggtccggc cccgcgtggc gccggtggcc gccgctaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page