(data stored in ACNUC9435 zone)

EMBL: CP000031.RPSH

CP000031.RPSH        Location/Qualifiers
FT   CDS_pept        498792..499184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPO0499"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by similarity to SP:P02361"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93816"
FT                   /db_xref="GOA:Q5LW44"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW44"
FT                   /protein_id="AAV93816.1"
FT                   /translation="MNDPIGDMLTRIRNAQLRGKSTVSTPGSKLRAWVLDVLADEGYIR
FT                   GYEKSTDVNGHPTLNIELKYYEGEPVIRELKRVSKPGRRVYMGVKDIPSVRQGLGVSIV
FT                   STPKGVMSDANARSNNVGGEVLCTVF"
     atgaacgatc ctatcggcga tatgctcacc cgtatccgca acgctcagct gcgcggcaaa        60
     agcacggtca gcacccccgg ttcgaaactg cgcgcctggg ttctggatgt cctggcggac       120
     gaaggctata tccgcggcta tgagaagtcg acggatgtca acggccaccc gacgctgaac       180
     atcgagctga aatactacga aggcgaaccc gtcattcgcg aactgaagcg ggtctccaag       240
     cccggtcgtc gcgtctatat gggcgtcaag gacatcccct cggtccgtca gggcctgggc       300
     gtgtcgattg tcagcactcc gaaaggtgtg atgtcggacg cgaacgctcg ctccaacaat       360
     gttggcggcg aagtgctctg caccgtcttc taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page