(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSN

CP000031.RPSN        Location/Qualifiers
FT   CDS_pept        498474..498779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SPO0498"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to SP:P02370"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93815"
FT                   /db_xref="GOA:Q5LW45"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW45"
FT                   /protein_id="AAV93815.1"
FT                   /translation="MAKKSMIEREKKRERLVAQYAAKRAELKEIANDESRPMEERFKAR
FT                   LKLAKLPRNSSATRLHNRCQLTGRPHAYYRKLKVSRIMLRELGSAGQIPGMVKSSW"
     atggctaaga aaagcatgat cgaacgcgag aagaagcgcg agcgtctggt ggcacaatat        60
     gccgcaaagc gcgccgagct gaaagaaatc gcaaacgacg agagccgccc gatggaagag       120
     cgcttcaagg cgcgtctgaa actggcgaaa ctgccgcgca acagctcggc aacccgtctt       180
     cacaaccgct gccagcttac cggccgtccg cacgcttact atcgtaagct caaggtcagc       240
     cggatcatgc tgcgcgagct ggggtctgct ggtcagatcc ccggcatggt gaaatcgagc       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page