(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSQ

CP000031.RPSQ        Location/Qualifiers
FT   CDS_pept        496888..497118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPO0494"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93811"
FT                   /db_xref="GOA:Q5LW49"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW49"
FT                   /protein_id="AAV93811.1"
FT                   /translation="MPKRILQGTVTSDANAQTVTVLVERRFTHPVLKKTIRKSKKYRAH
FT                   DEKNAFKVGDTVRIIECAPKSKTKRWEVLEA"
     atgcccaaac gtattctgca aggcaccgtg accagcgacg ccaacgcaca gaccgtgacc        60
     gtcctggtgg agcgtcgctt cacccatccg gttctgaaga agaccatccg taagtccaag       120
     aaataccggg ctcacgatga aaagaacgct ttcaaggtcg gcgacactgt ccgcatcatc       180
     gaatgcgcgc cgaaatcgaa aacgaaacgc tgggaagttc tggaagccta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page