(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSS

CP000031.RPSS        Location/Qualifiers
FT   CDS_pept        488414..488692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPO0485"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to SP:P02375"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93802"
FT                   /db_xref="GOA:Q5LW58"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW58"
FT                   /protein_id="AAV93802.1"
FT                   /translation="MSRSVWKGPFVDAYVLKKAAAVRESGRNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGQKHIPVNVTEDMIGQKFGEYSPTRTYYGHAADKKAKRK"
     atgtctcgct ctgtttggaa aggtcctttc gtcgatgctt atgtccttaa aaaggcagca        60
     gcagtgcgcg aatcgggccg taacgaagtc atcaagatct ggtcgcgccg gtccaccatc       120
     ctgccccagt tcgtgggtct gacctttggc gtgtacaacg gtcagaaaca catccccgtc       180
     aacgtcaccg aagacatgat cggtcagaag ttcggtgaat actcgccgac ccggacctat       240
     tacggtcacg cggctgacaa aaaagcgaag cggaagtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page