(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSU

CP000031.RPSU        Location/Qualifiers
FT   CDS_pept        complement(248574..248780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SPO0229"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93554"
FT                   /db_xref="GOA:Q5LX29"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX29"
FT                   /protein_id="AAV93554.1"
FT                   /translation="MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAR
FT                   EKAEAIRRARKLARKKAQREGML"
     atgcaggtta gtgttcgcga caacaacgtc gatcaggcgc ttcgtgccct gaagaagaag        60
     ctgcagcgcg aaggcgtttt ccgtgaaatg aagctgaagc aacatttcga gaaaccgtcc       120
     gagaaaaaag cgcgcgagaa agctgaagcg atccgccgtg cccgcaagct ggcacgcaag       180
     aaagcacagc gcgaaggcat gctctaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page