(data stored in ACNUC9435 zone)

EMBL: CP000031.RTCR

CP000031.RTCR        Location/Qualifiers
FT   CDS_pept        complement(172724..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcR"
FT                   /locus_tag="SPO0156"
FT                   /product="transcriptional regulator RtcR"
FT                   /note="identified by similarity to SP:P38035; match to
FT                   protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93484"
FT                   /db_xref="GOA:Q5LWU7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU7"
FT                   /protein_id="AAV93484.1"
FT                   /translation="MRNVVIGFLGTQLDSGKRKRWKPSVSLCNQPDFPVDRLELLYDQK
FT                   FLRLAENVRREIEVTSPKTEVLLRQLNLSDPWDFQEVYGKLFDLARDYGFDEDRERYFV
FT                   HLTTGTHVAQICWFLLTESRHVPAKLAQTGPPRDEKDGPGKLDIIDLDLSRYNALQQRF
FT                   DLLAREYSDLLKGGIETKSAAYNAVIDRIELVASSSDAPILLLGDSGTGKTELAQRIYE
FT                   LKLQRRRVKGRLVQINCATLRGSSALATLFGQRRSHTGQAGSERSGLLHEASGGVLFLD
FT                   EVDELGLDEQAALLHAIETGRYYPLGSDHEVTSRFQVIAGTSRDPVHLTAEGRFRPDLL
FT                   ARLNMWSFRLPALRDRREDIEANLIFELARAERELGTQVGFNTDARDLFLRFARDPATL
FT                   WPGNFRDFGSAIRRLCTLAPRGRITRAMVEEEIKGLRTGWQRAAGDGDHRLLIGILGNQ
FT                   AAEIDPFDRVQLAEVIRVCRTSASLSEAGRRLFAVSRTQRRTTNDADRLRKYLQRFGLE
FT                   WAMIAE"
     atgcgcaatg tggtcatcgg attcctcggc acccagcttg acagcggcaa gcgcaagcgc        60
     tggaagccga gtgtcagcct ttgcaatcag cctgatttcc cggttgaccg gctggagctg       120
     ctttacgatc agaaattcct gcgcctggcc gagaacgttc ggcgcgagat cgaagtcacc       180
     tcacccaaga ccgaggtcct gctccgccag ctgaacctat ccgatccctg ggattttcag       240
     gaggtctatg gcaagctttt cgacctcgcc cgcgactatg gctttgacga ggatcgcgag       300
     cgctatttcg tccacctgac caccggcacc catgttgcgc agatctgctg gtttctgctg       360
     accgaaagcc gtcatgtgcc cgccaagctg gcccagaccg gcccgccgcg cgacgaaaag       420
     gacggccccg gcaagctaga catcatcgac cttgacctca gccgctacaa tgcgctgcaa       480
     cagcgtttcg acctattggc ccgcgaatac agcgacctct tgaagggcgg gatcgagacg       540
     aaaagcgcgg cctataatgc ggtcatcgac cgaatcgaac tggtggccag cagttcggac       600
     gcgcccatcc tgctgctggg ggacagcggc accggcaaga ccgaactggc ccagcggatt       660
     tacgaactga agctgcaaag gcggcgggtg aaggggcggc ttgtgcagat caactgcgcc       720
     actttgcggg gaagttccgc attggccacg ctcttcggac agcgccgcag ccataccggg       780
     caggcgggca gcgaacgcag cggcctgttg cacgaggcca gcggcggtgt gctgttcctt       840
     gatgaggtcg acgaacttgg gctggacgaa caggcggccc tgctgcacgc gatcgagacc       900
     gggcgctatt atccgcttgg ctcggaccac gaggtcacaa gccgctttca ggtcatcgcc       960
     ggaaccagcc gcgacccggt gcacctgacc gccgagggcc ggttccgccc cgatctgctg      1020
     gcgcggctca acatgtggag ctttcgcctg cccgcgctca gggatcggcg cgaggatatc      1080
     gaggcgaacc tcattttcga actggcgcgc gccgagcgcg agcttggcac acaggtcgga      1140
     ttcaacaccg atgcgcgcga cctattcctg cggtttgcgc gcgatccggc gacactctgg      1200
     cccggaaatt ttcgcgactt tggcagtgcg atccgccgtc tgtgcacgct cgccccgagg      1260
     gggcggatca cccgcgccat ggtcgaggaa gagatcaagg ggcttcggac gggctggcag      1320
     cgtgcagcgg gtgacggcga tcaccgcctg ctgatcggca tccttggaaa tcaggcggca      1380
     gagatcgacc cgttcgaccg ggtgcagctt gccgaggtga tccgtgtctg ccgaacgtcc      1440
     gccagcctca gcgaagcagg gcgacggttg tttgccgtct cgcgcacgca gcgccgaacc      1500
     acaaacgatg ccgaccgcct cagaaagtac ctccagcgct ttggtctgga atgggcgatg      1560
     attgcggaat ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page