(data stored in ACNUC9435 zone)

EMBL: CP000031.SDHA

CP000031.SDHA        Location/Qualifiers
FT   CDS_pept        371250..373055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SPO0360"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by similarity to SP:P31038; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF02910; match to protein family HMM TIGR01812; match to
FT                   protein family HMM TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93678"
FT                   /db_xref="GOA:Q5LXE8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE8"
FT                   /protein_id="AAV93678.1"
FT                   /translation="MAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPT
FT                   RSHTVAAQGGIAASLSNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEH
FT                   YGVPFSRTEEGKIYQRPFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAE
FT                   FYIEYFAIDLIMSEDGQCQGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMVARAGLALQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYA
FT                   PQYKDLAPRDYVSRSMTMEIREGRGVGKDGDHIHLNLSHLPAEALAERLPGISESAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYWGEVLNPTADNPTAIVPGLMAVGEAGCASVHG
FT                   ANRLGSNSLIDLVVFGRASAIRAGKVVDPEAANPVLNLASVEKAFDRFDGLRNAKGSVA
FT                   TADLRLEMQKTMQADAAVFRTAKTMAEGVEKMTAIAAKMDDLSVTDRSLVWNSDLMETL
FT                   ELTNLMPSALATIVGAEARKESRGAHAHEDFPTRDDENWRVHTISRVEGNKVELSYRPV
FT                   ITEPLTTEEQGGIALKKIAPKERTF"
     atggctgctt acgaatacga aacgcatgaa tacgatgtgg tcgtggtcgg cgccggcggt        60
     gccggtctgc gggccacgct gggcatggcc gaacaggggc tgcgcaccgc ttgcgtgacc       120
     aaggtgttcc cgacccgctc gcacaccgtg gccgcgcagg gcgggattgc cgcgtcgctg       180
     tcgaacatgg gtccggacca ctggcaatgg cacatgtacg ataccgtcaa gggctcggac       240
     tggctgggcg atactgacgc gatggaatac ctggcgcgcg aggcccccaa ggcggtgtac       300
     gagctggagc attacggcgt gccgttctcg cgcaccgaag agggcaagat ctatcagcgc       360
     ccgttcggcg ggcatacgac cgagttcggt gaaggcccgg cggtgcagcg tacctgtgcg       420
     gcggcggacc ggaccggtca cgcgatcctg catacgcttt atggccagtc gctgaagaac       480
     aacgccgagt tctatatcga gtatttcgcc atcgacctga tcatgtccga agacgggcaa       540
     tgccagggcg tggtctgctg gaagctggat gacggcacct tccacgtctt caacgccaag       600
     atggtggtgc tggcgaccgg tggttatggc cgtgcctatt tcagcgcaac ctcggcccat       660
     acctgcactg gcgacggcgg cggcatggtg gcccgcgcgg gtttggcgct gcaggacatg       720
     gaattcgtgc agttccaccc gaccggcatc tatggctcgg gctgcctgat caccgagggc       780
     gcacgcggcg agggcgggta tctgaccaac tccgagggcg agcggttcat ggagcgttat       840
     gcgccccagt acaaggacct ggcgccgcgc gactatgtca gccgctcgat gaccatggaa       900
     attcgcgaag gtcgcggcgt aggcaaggat ggcgatcata tccacctgaa cctgagtcac       960
     ctcccggccg aggcgctggc cgaacggctg ccgggcatct cggaaagcgc caagatcttt      1020
     gcaggggtcg acgtgaccaa ggaaccgatc ccggttctgc ccaccgtgca ttacaacatg      1080
     ggcggcatcc cgaccaacta ttggggcgag gtgctgaacc ccaccgccga caacccgacc      1140
     gccatcgtgc ccggcctgat ggccgtgggc gaggccggtt gcgcctcggt gcacggggcc      1200
     aatcgcctcg gctcgaactc gctgattgac ctggtggtct ttggccgtgc ctcggccatt      1260
     cgcgccggca aggtggtgga ccccgaggcc gcgaacccgg tgctgaacct cgcctcggtc      1320
     gaaaaggcgt ttgatcgttt cgacgggctg cgcaacgcca agggctctgt cgccaccgcc      1380
     gatttgcggc tggagatgca gaaaaccatg caagccgatg cggccgtgtt ccgcaccgcc      1440
     aaaaccatgg ccgagggcgt cgagaagatg accgcgatcg ccgccaagat ggacgatctg      1500
     agcgtcaccg accgtagcct ggtctggaac agcgacctga tggaaacgtt ggaactgacc      1560
     aacctgatgc ccagcgcgct ggccaccatc gtcggcgccg aggcgcgcaa ggaaagccgt      1620
     ggcgcccatg cgcacgaaga tttcccgacc cgcgacgacg agaactggcg ggtgcacacc      1680
     atcagccggg tcgaaggcaa caaggtcgag ctcagctatc gcccggtcat caccgagccg      1740
     ctcactaccg aagagcaggg cggtatcgcc ttgaaaaaga tcgcaccgaa agaaaggaca      1800
     ttctga                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page