(data stored in ACNUC7421 zone)

EMBL: CP000031.SDHB

CP000031.SDHB        Location/Qualifiers
FT   CDS_pept        373340..374119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SPO0361"
FT                   /product="succinate dehydrogenase, iron-sulfur protein"
FT                   /note="identified by match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93679"
FT                   /db_xref="GOA:Q5LXE7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE7"
FT                   /protein_id="AAV93679.1"
FT                   /translation="MVQLTLPKNSRLTTGKTWPKPEGATNLRKFQIYRWNPDDGQNPRV
FT                   DTYFVDMDDCGPMVLDALIYIKNKVDATLTFRRSCREGICGSCAMNIDGINTLACIYGM
FT                   DEIKGDVKIYPLPHMPVVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRRK
FT                   LDGLYECVMCASCSTSCPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDNLEDPF
FT                   KLYRCHTIMNCAKTCPKGLNPAKAIAEIKKMMVERTV"
     atggtacaac tgacactccc caagaacagc cgcctcacca ccggcaagac ctggcccaag        60
     cccgaaggcg cgaccaatct gcgcaagttc cagatttacc gctggaatcc cgatgacggg       120
     cagaacccgc gggtagatac ctatttcgtc gatatggacg attgcgggcc gatggttctg       180
     gacgcgctca tctatatcaa gaacaaggtc gatgcgacgc tgaccttccg ccgttcgtgc       240
     cgcgagggga tctgcggctc ctgtgcgatg aatatcgacg ggatcaacac gctggcctgt       300
     atctatggca tggacgagat caagggcgac gtgaaaatct atccgctgcc gcatatgccg       360
     gtggtcaagg acctgatccc cgacctgacg catttctatg cccagcacgc ctcgatcatg       420
     ccctggctgg aaaccaagac caaccgcccg gccaaggagt ggaaacagtc gatcgaggat       480
     cgtcgcaagc tggacggtct ctatgaatgc gtcatgtgcg cgtcctgctc gacctcgtgc       540
     cccagctact ggtggaacgg tgaccgctac ctcggccctg ccgcgctgct gcatgcctat       600
     cgctggatca tcgacagccg ggacgaggca acgggtgaac gcctggacaa tctggaagac       660
     ccgttcaagt tgtatcgctg ccataccatc atgaattgcg ctaaaacctg cccgaaaggg       720
     ctgaacccgg ccaaagcgat tgccgaaatt aagaaaatga tggtggagcg cactgtttga       780
//

If you have problems or comments...

PBIL Back to PBIL home page