(data stored in ACNUC7421 zone)

EMBL: CP000031.SDHD

CP000031.SDHD        Location/Qualifiers
FT   CDS_pept        370862..371233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="SPO0359"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="identified by similarity to GB:AAC17941.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93677"
FT                   /db_xref="GOA:Q5LXE9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE9"
FT                   /protein_id="AAV93677.1"
FT                   /translation="MRYLTDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFG
FT                   PMLGEPHQAVLDYFSRPFPAIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVI
FT                   CLSYAAAATGLFAIARIAL"
     atgcgctatc tcacagaccg caaacgcgcc gttggcatgg gttcggccaa gacgggcacc        60
     gctcatttct gggctatgaa ggtcagctcg gtggccctgc tgatcctgat cccgctgttc       120
     gtgttcacct ttggcccgat gctgggcgag ccgcatcagg cggtgctcga ctatttctcg       180
     cgccccttcc cggccatcgt tgccgccttg acgctggtcg tcggtttcaa acatttcgcc       240
     gacggcgccc aggtgctgat cgaggattac gtgcatggcc tgatgcagaa aatcctgatc       300
     atcctggtga tctgcctttc ctatgccgct gctgcgaccg gccttttcgc catcgcccgc       360
     atcgcccttt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page