(data stored in ACNUC7421 zone)

EMBL: CP000031.SECY

CP000031.SECY        Location/Qualifiers
FT   CDS_pept        503545..504912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SPO0506"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93823"
FT                   /db_xref="GOA:Q5LW37"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW37"
FT                   /protein_id="AAV93823.1"
FT                   /translation="MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPV
FT                   PGIDGVALREFMEQAGQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTAMVP
FT                   SLEQLKKEGEQGRKKINQYTRLGTVALATVQAYGLAVSLESGDLATEPGMYFRFATMIT
FT                   LVGGTMFLMWLGEQITARGIGNGVSLIIFVGIIAEVPAALAQFFASGRSGAISPAVIIA
FT                   IILMVIAVITFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFAS
FT                   SLLLLPVTISTFSSGAANGPVMSWLLANFGPGQPLYLLFFVSMIVFFAYFYTFNVSFKP
FT                   DDVAQNLKNQNGFVPGIRPGKKTAEYLEYVVNRVLVLGSAYLAAVCLLPEIMRGQFNVP
FT                   FYFGGTSVLIIVSVTMDTIQQVQSHLLAHQYEGLIEKSQLRGKNRKRTNRKGPARR"
     atggtatcag cagcagaaca aatggcggcc aacaccagct ggtccgccct gggcaaggcc        60
     acggacctgc gcaatcggat cctgttcacg ctggggctcc tcatcgtcta tcgtctgggc       120
     acgttcattc ccgtgccggg catcgacggc gtggcgctgc gcgagttcat ggagcaggcg       180
     gggcagggca tcggcggcat ggtgtcgatg ttcaccggtg gcgcgctggg gcggatgggc       240
     atctttgccc tgggcatcat gccttatatc tcggcctcga tcatcgttca gctgttgacg       300
     gccatggtcc cctcgcttga gcaactcaag aaagagggtg agcagggccg caagaagatc       360
     aaccagtata cgcgcctggg caccgtggcc ctggccaccg tgcaggccta tggtctggcg       420
     gtttcgctgg aatcgggtga cctggctacc gagccgggca tgtatttccg ctttgccacc       480
     atgatcaccc tggtgggcgg caccatgttc ctgatgtggc tgggcgagca gatcaccgcc       540
     cgtggcatcg gcaacggcgt ttcgctgatc atctttgtcg gcatcatcgc cgaggtcccc       600
     gccgcgctgg cgcagttctt cgcctccggc cgttcgggcg ccatcagccc cgccgtgatc       660
     atcgccatca tcctgatggt gatcgcggtc atcacgtttg tggtgttcat ggagcgtgcg       720
     ctgcgcaaga tccacatcca gtatccccgc cgtcaggtgg gcatgaaggt ctatgacggc       780
     ggctccagcc acctgccggt caaggtcaac cccgcaggcg tgatcccggc gatcttcgcc       840
     agctcgctgc tgctgttgcc ggtgaccatc tcgaccttct cttcgggggc agcgaacggg       900
     ccggtgatgt cctggcttct ggcgaatttc ggccccggtc agccgctcta tctgctgttc       960
     ttcgtgtcga tgatcgtgtt ctttgcgtat ttctatacct tcaacgtctc gttcaaaccc      1020
     gatgacgtgg cgcagaacct gaagaaccag aacggctttg tccccggtat ccgtccgggc      1080
     aagaagaccg ccgagtatct ggaatatgtg gtcaaccgcg tgctggtgct gggttcggcc      1140
     tatctggccg ccgtctgcct gctgcccgag atcatgcgtg gccagttcaa cgtgccgttc      1200
     tatttcggtg gcacctcggt gctgatcatc gtctcggtga ccatggatac cattcaacag      1260
     gtccagagcc acctgctggc acatcagtac gaaggtctga tcgaaaaatc gcagcttcgc      1320
     ggcaagaatc gcaagcgcac gaacaggaag ggaccggcgc gtcgatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page