(data stored in ACNUC7421 zone)

EMBL: CP000031.SUCB

CP000031.SUCB        Location/Qualifiers
FT   CDS_pept        complement(353635..355143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="SPO0343"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93661"
FT                   /db_xref="GOA:Q5LXC8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC8"
FT                   /protein_id="AAV93661.2"
FT                   /translation="MTIEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVT
FT                   VEVPAPAAGVMGDIVAKEGETVGVNALLATITAGEGAAAAPAAPAAAAPAASSGGSVDV
FT                   MVPTLGESVTEATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEIVAAEG
FT                   ATVNASAKLAVISGSASGASPAPAAPAAAVTPAVATGKDIANAPSAEKAMAEAGITPAQ
FT                   VTGTGRDGRIMKEDVTAAVAAAAAAPAPAAAAPAPAAAPRAPALAEDAAREERVRMTRL
FT                   RQTIARRLKDAQNTAAILTTYNEVDMTEVMALRNTYKDAFEKKHGVRMGFMSFFTKACC
FT                   HALKEVPEVNAEIDGQDIVYKNYVHMGVAAGTPQGLVVPVIRDADQMSFAEIEKAIAEK
FT                   GKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMVINGE
FT                   IKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL"
     atgacgatcg aagttcgtgt ccccacgctt ggcgaatccg tgaccgaggc caccgtggcc        60
     acctggttca agaaacccgg cgacgccgtg gccgtcgacg agatgctctg tgagctggaa       120
     accgacaagg tgaccgtcga ggtccccgcc cctgccgccg gtgtgatggg tgatattgtc       180
     gccaaggaag gcgaaacggt tggcgtcaac gcgctgctgg ccaccattac cgccggtgaa       240
     ggggccgctg cggcccccgc cgcacctgcc gcagccgcac ccgccgccag ctcgggcggt       300
     tcggtcgatg tcatggtgcc gaccttgggt gaatcggtga ccgaggccac cgtctcgacc       360
     tggttcaaga aggtcggcga cagtgtcgcg caggacgaga tgctgtgcga gctggagacc       420
     gacaaggtct cggtcgaagt gcccgcaccc gcgtcgggcg tattgaccga aatcgtcgcc       480
     gccgaaggcg ccaccgtgaa cgcatctgcc aagctggcgg tgatctcggg cagcgcctcg       540
     ggcgccagcc ctgctccggc cgcccccgcc gccgcggtca cccccgcggt cgccacgggc       600
     aaggacatcg ccaacgcgcc ctcggcggaa aaggcgatgg ccgaggccgg gatcaccccc       660
     gcgcaggtca ccggaaccgg gcgcgatggt cgcatcatga aagaggatgt cactgccgcc       720
     gtggccgccg cagcagccgc gccggcccct gccgctgccg ctccggcccc tgccgccgcc       780
     ccccgcgcgc ccgcccttgc ggaggatgcc gcgcgcgaag agcgcgtccg catgacccgc       840
     ctgcgccaga ccatcgcccg ccgcctgaag gatgcccaga acaccgccgc gatcctgacc       900
     acctataacg aggtcgacat gaccgaggtg atggcgctgc gcaacaccta caaggacgcg       960
     ttcgagaaga agcacggcgt gcgcatgggc ttcatgtcct tcttcaccaa ggcctgctgc      1020
     cacgcgctga aggaggtgcc cgaggtcaac gccgagatcg acggccagga catcgtctac      1080
     aagaactacg tgcatatggg cgtcgccgcg ggtacgccgc agggcctggt ggtgccggtg      1140
     atccgcgacg ccgaccagat gtcctttgcc gagatcgaaa aggcgatcgc cgaaaagggc      1200
     aagcgcgccc gtgacggcaa gctgtccatg gcggaaatgc agggcggcac cttcacgatc      1260
     tcgaacggcg gcgtctatgg ctcgctcatg tcctctccga tcctgaaccc cccgcagtcg      1320
     ggcatcctcg gcatgcacaa gatccaggac cgcccgatgg tcatcaacgg cgagatcaag      1380
     atccgcccga tgatgtacct ggcgctgtcc tacgatcacc gcatcgtcga cggcaagggc      1440
     gcggtgacct tcctcgtgcg cgtgaaagag gcgctggaag atccccgccg cctgctgatg      1500
     gatctgtaa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page