(data stored in ACNUC7421 zone)

EMBL: CP000031.SUCD

CP000031.SUCD        Location/Qualifiers
FT   CDS_pept        complement(359481..360365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="SPO0346"
FT                   /product="succinyl-CoA synthase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P07459; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02629; match to protein family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93664"
FT                   /db_xref="GOA:Q5LXC5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC5"
FT                   /protein_id="AAV93664.1"
FT                   /translation="MAVLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   MEHLGLPVFNSVHEAKHVTEANATVIYVPPPFAADSILEAIDAQMEVIVCITEGIPVLD
FT                   MMKVKRALEGSSSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVK
FT                   QTSDIGLGQSTAVGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFL
FT                   KDEAKKGRKKPVAGFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVADSP
FT                   ATLGEAVLEAIGK"
     atggcagtcc tcatcgacga aaacaccaaa gtgatctgtc agggctttac cggctcgcag        60
     ggcacattcc actctgaaca ggccatcgcc tatggcacca agatggtcgg cggtgtgact       120
     cccggcaaag gcgggatgga gcatctgggc ctgcccgtgt tcaactcggt ccacgaagcc       180
     aagcatgtga ccgaagccaa tgccaccgtg atctatgtgc cgccgccctt cgccgccgac       240
     tcgatccttg aggcgatcga cgcccagatg gaggtgatcg tctgcatcac cgaaggcatc       300
     ccggttctgg acatgatgaa ggtcaagcgc gcgctcgaag gctcgtcctc gcgcctgatc       360
     ggtcccaact gccccggcgt gatcacgccc gatgcctgca agatcggcat catgcccggc       420
     catatccaca agcgcggcag cgttggcgtt gtgtcccgct cgggcacgct gacctatgag       480
     gcggtgaaac agacctcgga tatcggtctg ggccagtcca ccgccgtggg catcggcggc       540
     gacccgatca aggggaccga gcatatcgac gtgctggaat ggttcctggc cgacgatgaa       600
     accgaaagca tcatcatgat cggtgaaatc ggcggcagcg ccgaggaaga agccgcccag       660
     ttcctgaagg atgaggccaa gaaaggccgc aagaagccgg tcgccggttt catcgcgggc       720
     cgcaccgccc ctccgggccg ccgcatgggc cacgcgggcg ccatcgtcgc cggcggcaag       780
     ggcggcgccg aggacaagat cgaagccatg cgttcggctg gcatcgtcgt ggccgacagc       840
     ccggcaaccc tgggcgaggc cgtgctggaa gcgatcggca agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page