(data stored in ACNUC9435 zone)

EMBL: CP000031.THIG

CP000031.THIG        Location/Qualifiers
FT   CDS_pept        48081..48845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="SPO0047"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by similarity to SP:P30139; match to
FT                   protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93378"
FT                   /db_xref="GOA:Q5LWJ1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWJ1"
FT                   /protein_id="AAV93378.1"
FT                   /translation="MRAFYGTELPNPLMLGTAQYPSPAILEQAFRASGAGVATVSLRRE
FT                   SGAGQTFWSMIRDLGVLILPNTAGCHTVKEAVTTAHMAREVFGTPWIKLELIGHTDSLQ
FT                   PDVFGLIEAARILTEDGFQVFPYTTDDLIVGERLLAAGCEVLMPWGAPIGSGRGLNNEY
FT                   ALRAMRAEFPDTPLVVDAGIGLPSHAARALELGYDAVLLNTAVARAGDPVEMARAMALA
FT                   IQAGQLAHRADPIEARDMASASTPVIGKAFLS"
     atgcgcgcct tttacggaac cgaattgccg aacccgctga tgctgggcac cgcgcaatat        60
     cccagccccg cgatcctgga acaggcgttt cgcgctagcg gggccggggt agccaccgta       120
     tcgctgcggc gcgaatccgg ggctggacag accttttggt cgatgatccg cgatctgggt       180
     gtgctgatcc tgcccaatac cgctggttgc cacacggtga aagaggcggt gaccaccgcc       240
     catatggcgc gcgaggtctt tggcacgccc tggatcaagc tggaactgat cggccatacc       300
     gacagcctgc aaccggatgt cttcggcttg atcgaggctg cgcgcattct gaccgaagac       360
     gggtttcagg tgtttcccta tacgactgac gacctgatcg tcggcgaacg gctgctggcg       420
     gcggggtgcg aggtgctgat gccctggggc gcgcccatcg gctcgggccg ggggctgaac       480
     aacgaatatg cgctgcgcgc catgcgggcc gagttcccgg acacgcctct cgtggtcgat       540
     gcgggcatcg gccttcccag ccatgccgcc cgtgccttgg aacttggcta tgacgcggtt       600
     ctgctcaaca ccgccgtggc ccgtgcgggc gacccggtgg agatggcgcg cgccatggca       660
     ctggccattc aggccgggca actggcgcat cgcgccgacc cgatcgaggc acgcgatatg       720
     gccagcgcct caacccctgt gatcggaaag gcattcctgt catga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page