(data stored in ACNUC7421 zone)

EMBL: CP000031.TRPS

CP000031.TRPS        Location/Qualifiers
FT   CDS_pept        complement(404139..405155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="SPO0392"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by similarity to SP:P00953; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93710"
FT                   /db_xref="GOA:Q5LWF0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF0"
FT                   /protein_id="AAV93710.1"
FT                   /translation="MTETQFTPRVFSGIQPSGNLHLGNYLGALKRFVDMQGPEMETVYC
FT                   MVDLHAITVWQDPKELAHSTRELCAGFIAAGIDPEQSILFNQSQVPEHAQLAWIFNCVA
FT                   RMGWMQRMTQWKDKAGKNQQNASLGLFAYPSLMAADILIYHATHVPVGEDQKQHLELTR
FT                   DIAIKFNNDFGVDFFPVTEPVIEGAATRVMSLRDGTKKMSKSDPSDMSRINMTDDADAI
FT                   AQKIRKAKTDPDALPSEIDGLEGRPDARNLINIYAALADRSVEQVLADVGGKQFGEFKP
FT                   MLAELAVAKLSPISSEMARLMNDQAEIDRILARGAERARAITAPILKRTYEIVGMVS"
     atgaccgaaa cccagttcac gccgcgtgtg ttttccggca tccagccttc gggaaacctg        60
     catcttggga actacctcgg agcgctcaag cgatttgtgg atatgcaggg acccgagatg       120
     gagaccgttt attgcatggt cgatctccac gcgattaccg tctggcagga tcccaaggaa       180
     cttgcgcatt ccacgcggga actgtgtgca ggcttcatcg cagccgggat cgatccggaa       240
     cagtcgatcc tgttcaatca aagccaagtg cccgaacatg cgcaactggc ctggatcttc       300
     aactgtgtcg cccgcatggg ctggatgcag cggatgaccc aatggaaaga caaggccggc       360
     aagaaccagc agaacgcctc gctgggtctg tttgcctatc cgtcgctgat ggccgccgac       420
     atcctgatct atcatgccac ccatgtgccg gtgggcgagg accagaaaca gcatttggaa       480
     ctgacccgcg acatcgcgat caagttcaac aacgatttcg gagtcgattt ctttccggtc       540
     actgaaccgg tgattgaggg cgccgcgacc cgggtgatga gcttgcggga cggcaccaag       600
     aagatgtcca agtcagaccc gtccgacatg agccggatca acatgaccga cgatgccgac       660
     gccatcgcgc agaaaatccg caaggccaag accgacccgg atgccctgcc ctcggagatc       720
     gacgggctgg aggggcggcc ggacgcacgc aacctgatca acatctatgc tgcccttgcc       780
     gaccggagcg tcgagcaggt gcttgcggat gtgggcggca agcaatttgg cgagttcaag       840
     ccgatgctgg ccgaactggc cgttgcgaaa ctgtccccga tctcgtccga gatggcgcgg       900
     ctgatgaacg atcaggccga gatcgaccgc atcctggccc gtggcgccga acgcgcccgc       960
     gccatcaccg cgccgatcct gaagcggacc tatgaaatcg tcggcatggt gtcgtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page