(data stored in ACNUC7421 zone)

EMBL: CP000031.UBIE

CP000031.UBIE        Location/Qualifiers
FT   CDS_pept        complement(160766..161539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="SPO0145"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /note="identified by similarity to SP:P27851; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93473"
FT                   /db_xref="GOA:Q5LWU0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU0"
FT                   /protein_id="AAV93473.1"
FT                   /translation="MRGTARPMSDRSDKTTHFGFETVPEHEKAGRVQGVFGSVASKYDV
FT                   MNDVMSMGIHRVWKDAMMDWLAPRPGQRLLDVAGGTGDISFRFLKRAGHGHATVLDLTE
FT                   PMLVEGRKRAEAERMADSLDWVVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAY
FT                   RVLRPGGRLMVLEFSQLPNDGLQKLYDLYSFNVIPRMGQLIANDSASYQYLVESIRNFP
FT                   NQETFLGMVQAAGFGNAKYRNLSMGIAALHSGWKI"
     atgcgaggaa cggcaagacc catgtccgac agatccgaca agaccaccca tttcggcttt        60
     gaaaccgtgc ccgagcatga aaaggcgggc cgggtgcagg gcgtgttcgg gtcggtcgcc       120
     tcgaaatacg atgtcatgaa cgatgtgatg tcgatgggca tccaccgggt ctggaaagac       180
     gcgatgatgg attggctggc gccgcgcccg ggccagcgcc tgctggatgt ggcggggggg       240
     accggcgata tctcgttccg gttcctgaaa cgcgcgggcc atggccatgc caccgttctg       300
     gacctgaccg agccgatgct ggtcgaaggc cgcaagcggg ccgaggccga gcgtatggcc       360
     gacagtctcg actgggtggt gggcgacgcc atggcgctgc cgttcgagga taacacgttc       420
     gacgtctaca caatctcttt cggcatccgg aacgtgaccc gcccgcaaga ggccctgaac       480
     gaagcctacc gcgtgctgcg ccccggtggc cgcctgatgg tgctcgagtt cagccaattg       540
     cctaatgacg ggctgcaaaa gctctatgat ctttacagtt tcaacgtgat cccgcgcatg       600
     ggccagctga tcgccaatga cagcgccagc tatcagtatc tggtggaatc gatccgcaac       660
     ttccccaatc aggaaacgtt cctgggcatg gtccaggcgg cgggctttgg caatgccaaa       720
     taccgcaacc tgagcatggg catcgccgcg ctgcattccg gctggaagat ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page