(data stored in ACNUC9435 zone)

EMBL: CP000031.UDGA

CP000031.UDGA        Location/Qualifiers
FT   CDS_pept        300846..301631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="SPO0288"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to GB:CAD29336.1; match to
FT                   protein family HMM PF03167; match to protein family HMM
FT                   TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93606"
FT                   /db_xref="GOA:Q5LX74"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX74"
FT                   /protein_id="AAV93606.1"
FT                   /translation="MESALDPHTALALLQWQVELGVTETILDAPLDRYALPETAPRPPA
FT                   QAAADPRRPAMPAPPPKAPEVDPAQEAVRAARAVGSLDALRTALAEFEHCELKRGARNL
FT                   VFADGVPGARVMIIGEAPGRDEDREGRPFVGRAGQLLDRMLAAIGLSRSESVYITNVLP
FT                   WRPPQNRDPLPVEIGMMKPFLERHVALAKPEVLVLMGNISCETVLGRRGITRLRGQWTQ
FT                   AMGLPVLPMFHPAYLLRQPQMKRQAWADLLELQAKLRES"
     atggaatcgg cacttgaccc tcataccgcg ctggccctgc tgcaatggca ggtcgaactg        60
     ggcgtgaccg agacgatcct ggatgcgccg ctggatcgct atgcgctgcc ggaaaccgcg       120
     ccgcgcccgc ccgcgcaggc cgctgccgat ccgcgccgcc cggctatgcc cgccccgccc       180
     ccaaaggcac ccgaagtcga tccggcgcaa gaggctgtcc gcgccgcgcg cgcggtgggc       240
     tcgcttgacg cgctgcgcac ggcattggcc gagtttgaac attgcgagct gaagcgcggc       300
     gcccgtaacc tggtctttgc cgatggcgtg cccggcgcgc gggtgatgat catcggcgag       360
     gcgccgggcc gcgacgagga ccgcgagggg cggccctttg tcgggcgggc cggacagttg       420
     ctggaccgga tgctggcggc gatcggcctc agccggtcgg aaagcgtcta tatcaccaac       480
     gtcctgccct ggcggccccc gcagaaccgc gacccgctgc cggtggaaat cggcatgatg       540
     aaaccgtttc tggaacggca tgtggcattg gccaagcccg aggtgctggt gctgatgggc       600
     aatatcagct gcgagacggt gctgggccgg cgcggcatca cccggttgcg cgggcaatgg       660
     acccaagcca tgggcctgcc ggtgctgccg atgtttcacc cggcctatct gctgcgtcag       720
     ccgcagatga agcggcaggc ctgggccgat ctgctggaac ttcaggcaaa actgagagag       780
     tcgtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page