(data stored in ACNUC7421 zone)

EMBL: CP000031.UGPE

CP000031.UGPE        Location/Qualifiers
FT   CDS_pept        complement(257035..257886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="SPO0238"
FT                   /product="SN-glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P10906; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93563"
FT                   /db_xref="GOA:Q5LX33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX33"
FT                   /protein_id="AAV93563.1"
FT                   /translation="MVENRPILNVITHLVLILGIVIVALPIWITFVAATHDAVRMTQAP
FT                   IPMLPGTHFWENFTQTLFGSGLSGTETAPVWRMLLNSLAMAMMIALGKIAISLISAFAI
FT                   VYFKFPFRMFFFWLIFVTLMLPVEVRILPTFEVVADLGMLNSYWGLSIPLIASATATFM
FT                   FRQVFLTIPDEMLESARIDGAGPLRFFWDILIPLSRTNIAALFVILFIYGWNQYLWPLL
FT                   ITTDTDMTTIVMSIKQMLEAAEQSPQWNIIMMTALLAMLPPVFVVVAMQKLFVQGLTET
FT                   DK"
     atggtcgaaa atcgccccat cctgaatgtc atcacccatc tggttctgat ccttggcatc        60
     gtcatcgtcg cgctgccgat ctggatcacc tttgtcgccg ccacccatga cgcggtgcgc       120
     atgacacagg cgccgatccc gatgctgccg ggcacccatt tctgggagaa tttcactcag       180
     accctgtttg gctctggcct gagcgggacc gagaccgcac cggtctggcg gatgctgctc       240
     aacagcctgg ccatggcgat gatgatcgcc ttgggcaaga tcgcgatctc gctgatttcg       300
     gcctttgcca tcgtctattt caagtttccc ttccgcatgt tctttttctg gctgatcttc       360
     gtcaccctga tgctgccggt cgaggtgcgc atcctgccca cgttcgaagt ggtggccgat       420
     ctgggcatgc tcaacagcta ttggggcctg tcgatcccgc tgattgcctc ggccacggca       480
     acgttcatgt tccgccaggt gtttctgacc atccccgacg agatgctgga aagcgcgcgc       540
     atcgacgggg ccgggccgct gcgctttttc tgggatatcc tgatcccgct gtcgcgcacc       600
     aatatcgcgg cgctgttcgt gatcctcttc atctatggct ggaaccagta tctgtggccg       660
     ctgctgatta ccactgacac cgacatgacc accatcgtga tgagcatcaa gcaaatgctt       720
     gaggcggcgg aacagtcccc gcaatggaac atcatcatga tgaccgcgct gctggcgatg       780
     ctgccgccgg tcttcgtggt ggtcgcaatg caaaagctct ttgttcaggg cctgacagag       840
     accgacaaat ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page