(data stored in ACNUC7421 zone)

EMBL: CP000031.XSEB

CP000031.XSEB        Location/Qualifiers
FT   CDS_pept        complement(270485..270703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SPO0249"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93569"
FT                   /db_xref="GOA:Q5LX40"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX40"
FT                   /protein_id="AAV93569.1"
FT                   /translation="MSFEQAMKELETVVGQLERGDVALDQSIALYERGAALKKRCEDEL
FT                   KRAEEKVAAITLDSNGQPTGTKPVEGL"
     atgagctttg aacaggcgat gaaagagctg gaaaccgtgg tcggtcagct tgaacgcggc        60
     gatgttgcgc tggaccagtc catcgcgctt tacgaacgcg gcgcggcgct gaagaaacgc       120
     tgcgaggacg agttgaagcg cgccgaggaa aaggttgccg ccatcacgct cgacagtaat       180
     ggccagccca ccgggaccaa gccggtcgaa ggtctctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page