(data stored in ACNUC7421 zone)

EMBL: CP000038.COF

CP000038.COF         Location/Qualifiers
FT   CDS_pept        459598..460428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="SSON_0434"
FT                   /old_locus_tag="SSO_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0561"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87210"
FT                   /db_xref="GOA:Q3Z4V2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4V2"
FT                   /protein_id="AAZ87210.1"
FT                   /translation="MEKEMARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFA
FT                   TGRHALEMQHILGALSLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRA
FT                   SMHIFNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQ
FT                   IQLYEALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDRE
FT                   MLGSVGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
     gtggagaaag aaatggctcg tctggcagca tttgatatgg atggcacttt attgatgcct        60
     gaccatcatt taggtgagaa aaccctctct actttggcgc gactgcgtga acgcgacatt       120
     accctcactt ttgccacggg gcgtcatgcg ctggagatgc agcatattct cggggcgcta       180
     tcgctggatg catatttgat taccggcaac ggaacgcgcg tgcattctct ggaaggtgaa       240
     cttttacatc gtgatgattt acctgcggat gtcgcggagc tggtgctgta tcagcaatgg       300
     gatacccgag ccagcatgca tatcttcaat gacgacggtt ggtttaccgg gaaagagatc       360
     cctgcgttgt tgcaggcatt tgtctatagc ggttttcgtt atcagataat cgatgtcaaa       420
     aaaatgccac tcggcagcgt caccaagatc tgcttctgtg gcgatcacga cgatcttaca       480
     cgcttgcaga tccagctata cgaagcatta ggcgagcgtg cacatttgtg tttttccgcc       540
     acagattgcc tcgaagtgct gccggtgggc tgcaataaag gcgctgcatt gacggtgctg       600
     acccaacatt taggtttatc gttgcgcgat tgcatggcct ttggtgatgc gatgaacgat       660
     cgcgaaatgt taggcagcgt cggtagcggg tttattatgg gcaatgcgat gccgcaactg       720
     cgcgcggagc tcccgcattt accggtgatt ggacattgcc gaaatcaggc tgtctctcac       780
     tatttgacgc actggctgga ctatccacat ctaccttatt cccccgaata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page