(data stored in ACNUC7421 zone)

EMBL: CP000038.FIXB

CP000038.FIXB        Location/Qualifiers
FT   CDS_pept        52522..53463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="SSON_0050"
FT                   /old_locus_tag="SSO_0050"
FT                   /product="FixB"
FT                   /note="probable flavoprotein subunit, carnitine metabolism;
FT                   Code: C; COG: COG2025"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86846"
FT                   /db_xref="GOA:Q3Z5W6"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5W6"
FT                   /protein_id="AAZ86846.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINTFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYAGVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
     atgaacacgt tttctcaagt ctgggtattc agcgataccc cttctcgtct gccggaactg        60
     atgaacggtg cgcaggcttt agctaatcaa atcaacacct ttgtcctcaa tgatgccgac       120
     ggcgcacagg caatccagct cggcgctaat catgtctgga aattaaacgg caaaccggac       180
     gatcggatga tcgaagatta cgccggtgtc atggctgaca ctattcgcca gcacggcgca       240
     gacggcctgg tgctgctgcc aaacacccgt cgcggcaaat tactggcggc aaaactgggt       300
     tatcgcctta aagcggcggt gtctaacgat gccagcaccg tcagcgtaca ggacggtaaa       360
     gcaacagtga aacatatggt ttacggtggt ctggcgattg gcgaagaacg cattgccacg       420
     ccgtatgcgg tactgaccat cagcagcggc acgttcgatg cggctcagcc agacgcgtca       480
     cgcactggcg aaacgcacac cgtggagtgg caggctccgg ctgtggcgat tacccgcacg       540
     gcaacccagg cgcgccagag caacagcgtc gatctcgaca aagcccgtct ggtggtcagc       600
     gtcggtcgcg gtattggcag caaagagaac attgcgctgg cagaacagct ttgcaaggcg       660
     ataggtgcgg agttggcctg ttctcgtccg gtggcggaaa acgaaaaatg gatggagcac       720
     gaacgctatg tcggtatctc caacctgatg ctgaaacctg aactgtacct ggcggtgggg       780
     atctccgggc agatccagca catggttggt gctaatgcat cgcaaaccat tttcgccatc       840
     aataaagata aaaatgcgcc gatcttccag tacgcggatt acggcattgt tggtgacgcc       900
     gtgaagatcc ttccggcgct gaccgcagct ttagcgcgtt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page