(data stored in ACNUC7421 zone)

EMBL: CP000038.FTSL

CP000038.FTSL        Location/Qualifiers
FT   CDS_pept        100369..100734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SSON_0091"
FT                   /old_locus_tag="SSO_0091"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; Code: D; COG: COG3116"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86886"
FT                   /db_xref="GOA:Q3Z5S6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5S6"
FT                   /protein_id="AAZ86886.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     atgatcagca gagtgacaga agctctaagc aaagttaaag gatcgatggg aagccacgag        60
     cgccatgcat tgcctggtgt tatcggtgac gatcttttgc gatttgggaa gctgccactc       120
     tgcctgttca tttgcattat tttgacggcg gtgactgtgg taaccacggc gcaccatacc       180
     cgtttactga ccgctcagcg cgaacaactg gtgctggagc gagatgcttt agacattgaa       240
     tggcgcaacc tgatccttga agagaatgcg ctcggcgacc atagccgggt ggaaaggatc       300
     gccacggaaa agctgcaaat gcagcatgtt gatccgtcac aagaaaatat cgtagtgcaa       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page