(data stored in ACNUC7421 zone)

EMBL: CP000038.FTSZ

CP000038.FTSZ        Location/Qualifiers
FT   CDS_pept        114648..115799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SSON_0103"
FT                   /old_locus_tag="SSO_0103"
FT                   /product="FtsZ"
FT                   /note="cell division; forms circumferential ring;
FT                   tubulin-like GTP-binding protein and GTPase; Code: D; COG:
FT                   COG0206"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86898"
FT                   /db_xref="GOA:Q3Z5R4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5R4"
FT                   /protein_id="AAZ86898.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVANGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
     atgtttgaac caatggaact taccaatgac gcggtgatta aagtcatcgg cgtcggcggc        60
     ggcggcggta atgctgttga acacatggtg cgcgagcgta ttgaaggtgt tgaattcttc       120
     gcggtaaata ccgatgcaca agcgctgcgt aaaacagcgg ttggacagac gattcaaatc       180
     ggtagcggta tcaccaaagg actgggcgct ggcgctaatc cagaagttgg ccgcaatgcg       240
     gctgatgagg atcgcgatgc attgcgtgcg gcgctggaag gtgcagacat ggtctttatt       300
     gctgcgggta tgggtggtgg taccggtaca ggtgcagcac cagtcgtcgc tgaagtggca       360
     aaagatttgg gtatcctgac cgttgctgtc gtcactaagc ctttcaactt tgaaggcaag       420
     aagcgtatgg cattcgcgga gcaggggatc actgaactgt ccaagcatgt ggactctctg       480
     atcactatcc cgaacgacaa actgctgaaa gttctgggcc gcggtatctc cctgctggat       540
     gcgtttggcg cagcgaacga tgtactgaaa ggcgctgtgc aaggtatcgc tgaactgatt       600
     actcgtccgg gtttgatgaa cgtggacttt gcagacgtac gcaccgtaat gtctgagatg       660
     ggctacgcaa tgatgggttc tggcgtggcg aacggtgaag accgtgcgga agaagctgct       720
     gaaatggcta tctcttctcc gctgctggaa gatatcgacc tgtctggcgc gcgcggcgtg       780
     ctggttaaca tcacggcggg cttcgacctg cgtctggatg agttcgaaac ggtaggtaac       840
     accatccgtg catttgcttc cgacaacgcg actgtggtta tcggtacttc tcttgacccg       900
     gatatgaatg acgagctgcg cgtaaccgtt gttgcgacag gtatcggcat ggacaaacgt       960
     cctgaaatca ctctggtgac caataagcag gttcagcagc cagtgatgga tcgctaccag      1020
     cagcatggga tggctccgct gacccaggag cagaagccgg ttgctaaagt cgtgaatgac      1080
     aatgcgccgc aaactgcgaa agagccggat tatctggata tcccagcatt cctgcgtaag      1140
     caagctgatt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page