(data stored in ACNUC7421 zone)

EMBL: CP000038.GIP

CP000038.GIP         Location/Qualifiers
FT   CDS_pept        complement(531529..532380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gip"
FT                   /locus_tag="SSON_0503"
FT                   /old_locus_tag="SSO_0503"
FT                   /product="glyoxylate-induced protein"
FT                   /note="Code: G; COG: COG3622"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87276"
FT                   /db_xref="GOA:Q3Z4N6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4N6"
FT                   /protein_id="AAZ87276.1"
FT                   /translation="MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEEL
FT                   KQVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINC
FT                   LVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALK
FT                   LIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYD
FT                   YLFKVIENSDYNGWVGCEYKPQTTTEAGLRWMDPYFLNRVVATGKVMKPVLAQRQKVVS
FT                   PP"
     atgttacgtt tctctgctaa tttatcgatg ttatttggtg aatatgattt tctcgcccgt        60
     tttgagaaag ctgcgcagtg tggttttcgc ggcgttgaat ttatgtttcc ttatgactac       120
     gacattgaag aattaaaaca ggtgctggcg agtaataaac tcgaacatac gctgcacaat       180
     ctaccggcgg gtgactgggc ggcgggggag cgcggtattg cctgtattcc tggccgtgaa       240
     gaagagtttc gggatggcgt agcagcagcg attcgttatg cccgtgcgct ggggaataaa       300
     aaaattaact gtctggtcgg taaaacgccg gctggtttca gcagtgaaca gattcacgca       360
     acgcttgtag aaaacctgcg ttatgccgcg aatatgctga tgaaagaaga tattttatta       420
     ctgattgaac ctattaacca ttttgatatt cctggtttcc atctcaccgg aactcggcag       480
     gcgctgaaat tgattgatga tgttggttgc tgcaatttga aaattcagta tgacatttat       540
     cacatgcagc ggatggaagg tgaattaacc aacaccatga ctcagtgggc cgataaaatt       600
     ggtcacctgc aaattgctga taatccgcat cgcggcgaac cggggaccgg agaaattaat       660
     tatgattatc tctttaaggt aatcgaaaat tctgactaca acggttgggt tgggtgtgaa       720
     tataaacccc aaaccaccac ggaagccggt ttacgctgga tggatccgta ctttctgaac       780
     cgggtcgtag ccactgggaa ggttatgaaa ccggtactcg cgcagcggca aaaggtggta       840
     tcaccaccat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page