(data stored in ACNUC7421 zone)

EMBL: CP000038.GSK

CP000038.GSK         Location/Qualifiers
FT   CDS_pept        492209..493513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="SSON_0464"
FT                   /old_locus_tag="SSO_0464"
FT                   /product="inosine-guanosine kinase"
FT                   /note="Code: G; COG: COG0524"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87240"
FT                   /db_xref="GOA:Q3Z4S2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4S2"
FT                   /protein_id="AAZ87240.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
     atgaaatttc ccggtaaacg taaatccaaa cattacttcc ctgtaaatgc acgcgatccg        60
     ctgcttcagc aattccagcc agaaaacgaa accagcgccg cctgggtcgt aggtattgac       120
     cagacgctgg tcgatattga agcgaaagtg gatgatgaat tcattgagcg ttatggatta       180
     agcgccgggc attcactggt gattgaggat gacgtagccg aagcgcttta tcaggagcta       240
     aaacagaaaa acctgattac ccatcagttt gcgggtggca ccattggtaa caccatgcac       300
     aactactcgg tgctcgcgga cgaccgttcg gtgctgctgg gcgtcatgtg cagcaatatt       360
     gaaattggca gttatgccta tcgttacctg tgtaacactt ccagccgtac cgatcttaac       420
     tatctacaag gcgtggatgg cccgattggt cgttgcttta cgctgattgg cgagtccggg       480
     gaacgtacct ttgctatcag tccaggccac atgaaccagc tgcgggctga aagcattccg       540
     gaagatgtga ttgccggagc ctcggcactg gttctcacct cttatctggt gcgttgcaaa       600
     ccgggtgaac ccatgccgga agcaaccatg aaagccattg agtacgcgaa gaaatataac       660
     gtaccggtgg tgctgacgct gggcaccaag tttgtcattg ccgagaatcc gcagtggtgg       720
     cagcaattcc tcaaagatca cgtctctatc cttgcgatga acgaagatga agccgaagcg       780
     ttgaccggag aaagcgatcc gttgttggca tctgacaagg cgctggactg ggtagatctg       840
     gtgctgtgca ccgccgggcc aatcggcttg tatatggcgg gctttaccga agacgaagcg       900
     aaacgtaaaa cccagcatcc gctgctgccg ggcgctatag cggaattcaa ccagtatgag       960
     tttagccgcg ccatgcgcca caaggattgc cagaatccgc tgcgtgtcta ttcgcacatt      1020
     gcgccgtaca tgggcgggcc ggaaaaaatc atgaacacta atggagcggg ggatggcgca      1080
     ttggcagcgt tgctgcatga cattaccgcc aacagctacc atcgtagcaa cgtaccaaac      1140
     tccagcaaac ataaattcac ctggttaact tattcatcgt tagcgcaggt gtgtaaatat      1200
     gctaaccgtg tgagctatca ggtactgaac cagcattcac ctcgtttaac gcgcggcttg      1260
     ccggagcgtg aagacagcct ggaagagtct tactgggatc gttaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page