(data stored in ACNUC7421 zone)

EMBL: CP000038.HLPA

CP000038.HLPA        Location/Qualifiers
FT   CDS_pept        215403..215888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="SSON_0190"
FT                   /old_locus_tag="SSO_0190"
FT                   /product="histone-like protein"
FT                   /note="located in outer membrane or nucleoid; Code: M; COG:
FT                   COG2825"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86982"
FT                   /db_xref="GOA:Q3Z5I0"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5I0"
FT                   /protein_id="AAZ86982.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
     gtgaaaaagt ggttattagc ggcaggtctc ggtttagcac tggcaacttc tgctcaggcg        60
     gctgacaaaa ttgcaatcgt caatatgggc agcctgttcc agcaggtagc gcagaaaacc       120
     ggtgtttcta acacgctgga aaatgagttc aaaggccgtg ccagcgaact gcagcgtatg       180
     gaaaccgatc tgcaggctaa aatgaaaaag ctgcagtcca tgaaagcggg cagcgatcgc       240
     actaagctgg aaaaagacgt gatggctcag cgccagactt ttgctcagaa agcgcaggct       300
     tttgagcagg atcgcgcacg tcgttccaac gaagaacgcg gcaaactggt tactcgtatc       360
     cagactgctg tgaaatccgt tgccaacagc caggatatcg atctggttgt tgatgcaaac       420
     gccgttgctt acaacagcag cgatgtaaaa gacatcactg ccgacgtact gaaacaggtt       480
     aaataa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page