(data stored in ACNUC7421 zone)

EMBL: CP000038.HOLA

CP000038.HOLA        Location/Qualifiers
FT   CDS_pept        complement(631857..632888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SSON_0594"
FT                   /old_locus_tag="SSO_0594"
FT                   /product="DNA polymerase III delta subunit"
FT                   /note="Code: L; COG: COG1466"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87360"
FT                   /db_xref="GOA:Q3Z4F2"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4F2"
FT                   /protein_id="AAZ87360.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVTARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMGEALNRLSQTQLRQAVQLLTRTELTLKQDYGQSVWAELKGLSLLLCHKPLADVF
FT                   IDG"
     atgattcggt tgtacccgga acaactccgc gcgcagctca atgaagggct gcgcgcggcg        60
     tatcttttac ttggtaacga tcctctgtta ttgcaggaaa gccaggacgc tgttcgtcag       120
     gtagctgcgg cacaaggatt cgaagaacac cacacttttt ccattgatcc caacactgac       180
     tggaatgcga tcttttcgtt atgccaggct atgagtctgt ttgccagtcg acaaacgcta       240
     ttgctgttgt taccagaaaa cggaccgaat gcggcgatca atgaacaact tctcacactc       300
     accggacttc tgcatgacga cctgctgttg atcgtccgcg gtaataaatt aagcaaagcg       360
     caagaaaatg ccgcctggtt tactgctctt gcgaatcgca gcgtgcaggt gacctgtcag       420
     acaccggagc aggctcagct tccccgctgg gttactgcgc gcgcaaaaca gctcaactta       480
     gaactggatg acgcggcaaa tcaggtgctc tgctactgtt atgaaggtaa cctgctggcg       540
     ctggctcagg cactggagcg tttatcgctg ctctggccag acggcaaatt gacattaccg       600
     cgcgttgaac aggcggtgaa tgatgccgcg catttcaccc cttttcattg ggttgatgct       660
     ttgttgatgg gaaaaagtaa gcgcgcattg catattcttc agcaactgcg tctggaaggc       720
     agcgaaccgg ttattttgtt gcgcacatta caacgtgaac tgttgttact ggttaacctg       780
     aaacgccagt ctgcccatac gccactgcgt gcgttgtttg ataagcatcg ggtatggcag       840
     aaccgccggg gcatgatggg cgaggcgtta aatcgcttaa gtcagacgca gttacgtcag       900
     gccgtgcaac tcctgacacg aacggaactc accctcaaac aagattacgg tcagtcagtg       960
     tgggcagagc tgaaagggtt atctcttctg ttgtgccata aacccctggc ggacgtattt      1020
     atcgacggtt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page