(data stored in ACNUC7421 zone)

EMBL: CP000038.ILVH

CP000038.ILVH        Location/Qualifiers
FT   CDS_pept        95917..96408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="SSON_0085"
FT                   /old_locus_tag="SSO_0085"
FT                   /product="valine-sensitive acetolactate synthase III small
FT                   subunit"
FT                   /note="Code: E; COG: COG0440"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86880"
FT                   /db_xref="GOA:Q3Z5T2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5T2"
FT                   /protein_id="AAZ86880.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVASTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIREVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgcgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgtc aaccgatgat       120
     ccgacattat cgcgtatgac catccagacc gtgggcgatg aaaaagtact tgagcagatc       180
     gaaaagcaat tacacaagct ggtcgatgtc ttgcgcgtga gtgagttggg gcagggcgcg       240
     catgttgagc gggaaatcat gctggtgaaa attcaggcca gcggttacgg gcgtgacgaa       300
     gtgaaacgta atacggaaat attccgtggg caaattatcg atgtcacacc ctcgctttat       360
     accgttcaat tagcaggcac cagcgataag cttgatgcat ttttagcatc gattcgcgag       420
     gtggcgaaaa ttgtggaagt tgctcgttct ggtgtggtcg gactttcgcg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page