(data stored in ACNUC7421 zone)

EMBL: CP000038.ILVI

CP000038.ILVI        Location/Qualifiers
FT   CDS_pept        94190..95914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="SSON_0084"
FT                   /old_locus_tag="SSO_0084"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /note="Code: EH; COG: COG0028"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86879"
FT                   /db_xref="GOA:Q3Z5T3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5T3"
FT                   /protein_id="AAZ86879.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPHELESKLSEALEQVHNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc ttatcgatca gggcgttaaa        60
     caagtattcg gttatcccgg aggcgcagtc cttgatattt acgatgcatt gcataccgtg       120
     ggtggtatcg atcatgtttt agttcgtcat gagcaggcgg cagtgcatat ggccgatggt       180
     ctggcgcgcg cgaccgggga agtcggcgtc gtgctggtaa cgtcgggtcc aggggcgacc       240
     aatgcgatta ctggcatcgc caccgcttat atggattcca ttccattagt tgtcctttcc       300
     gggcaggtag cgacctcgtt gataggttac gatgcctttc aggagtgcga catggtgggg       360
     atttcgcgac cagtggttaa acacagtttt ctggttaagc aaacggaaga cattccgcag       420
     gtgctgaaaa aggctttctg gctggcggca agtggtcgtc ctggaccagt agtcgttgat       480
     ttaccgaaag atattcttaa tccggcgaac aaattaccct atgtctggcc ggagtcggtc       540
     agtatgcgtt cttacaatcc cactactacc ggacataaag ggcaaattaa gcgcgctctg       600
     caaacgctgg tagcggcaaa aaaaccggtt gtctacgtag gcggtggggc aatcacggcg       660
     ggctgccatc agcagttgaa agaaacggtg gaggcgttga atctgcccgt tgtttcctca       720
     ttgatggggc tgggagcgtt tccggcaacg catcgtcagg cactgggcat gctgggaatg       780
     cacggtacct acgaagccaa tatgacgatg cataacgcgg atgtgatttt cgccgtcggg       840
     gtacgatttg atgaccgaac gacgaacaat ctggcaaagt actgcccaaa tgccactgtt       900
     ctgcatatcg atattgatcc tacttccatt tctaaaaccg tgactgcgga tatcccgatt       960
     gtgggggatg ctcgccaggt cctcgaacaa atgcttgaac tcttgtcgca agaatccgcc      1020
     catcaaccac tggatgagat ccgcgactgg tggcagcaaa ttgaacagtg gcgcgctcgt      1080
     cagtgcctga aatatgacac tcacagtgaa aagattaaac cgcaggcggt gatcgagact      1140
     ctttggcggt tgacgaaggg agacgcttac gtgacgtccg atgtcgggca gcaccagatg      1200
     tttgctgcac tttattatcc attcgacaaa ccgcgtcgct ggatcaattc cggtggcctc      1260
     ggcacgatgg gttttggttt acctgcggca ctgggcgtca aaatggcgtt gccagaagaa      1320
     accgtggttt gcgtcactgg cgacggcagt attcagatga acatccagga actgtctacc      1380
     gcgttgcaat acgagttgcc cgtactggtg gtgaatctca ataaccgcta tctggggatg      1440
     gtgaagcagt ggcaggacat gatctattcc ggccgtcatt cacaatctta tatgcaatcg      1500
     ctacccgatt tcgtccgtct ggcggaagcc tatggtcacg tcgggatcca gatttctcat      1560
     ccgcatgagc tggaaagcaa acttagcgag gcgctggaac aggtgcacaa taatcgcctg      1620
     gtgtttgttg atgttaccgt cgatggcagc gagcacgtct acccgatgca gattcgcggg      1680
     ggcggaatgg atgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page