(data stored in ACNUC7421 zone)

EMBL: CP000038.LEUC

CP000038.LEUC        Location/Qualifiers
FT   CDS_pept        complement(88024..89424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SSON_0079"
FT                   /old_locus_tag="SSO_0079"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /note="dehydratase; Code: E; COG: COG0065"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86874"
FT                   /db_xref="GOA:Q3Z5T8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5T8"
FT                   /protein_id="AAZ86874.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFNGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKTGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVKRASAEKALAYMGLKPGIPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
     atggctaaaa cgttatacga aaaattattc gacgctcacg tagtgtacga agccgaaaac        60
     gaaaccccgc tgttatatat cgaccgccac ctggtgcatg aagtgacctc accgcaggcg       120
     ttcaatggtc tgcgcgccca cggtcgcccg gtacgtcagc cgggcaaaac cttcgccact       180
     atggatcaca acgtctctac ccagacgaaa gacattaatg cctgtggtga aatggcgcgc       240
     atccagatgc aggagctgat taaaaactgc aaagaatttg gcgtcgaact gtatgacctg       300
     aatcacccgt atcaggggat cgtccacgta atggggccgg aacagggcgt caccttgccg       360
     gggatgacca ttgtctgcgg cgactcgcat accgccaccc acggcgcgtt tggcgcactg       420
     gcctttggta tcggcacttc cgaagttgaa cacgtactgg caacgcaaac cctgaaacag       480
     ggccgcgcaa aaaccatgaa aattgaagtc cagggcaaag ccgcgccggg cattaccgca       540
     aaagatatcg tgctggcaat tatcggtaaa accggtagcg caggcggcac cgggcatgtg       600
     gtggagtttt gcggcgaagc aatccgtgat ttaagcatgg aaggtcgtat gaccctgtgc       660
     aatatggcaa tcgaaatggg cgcaaaaacc ggtctggttg caccggacga aaccaccttt       720
     aactatgtca aaggccgttt gcatgcgccg aaaggcaaag atttcgacga cgccgttgcc       780
     tactggaaaa ccctgcaaac cgacgaaggc gcaactttcg ataccgttgt cactctgcaa       840
     gcagaagaaa tttcaccgca ggtcacctgg ggcaccaatc caggccaggt gatttccgtg       900
     aacgacaata ttcccgatcc ggcttcgttt gccgatccgg ttaaacgcgc gtcggcagaa       960
     aaagcgctgg cctatatggg gctgaaaccg ggcattccgc tgaccgaagt ggctatcgac      1020
     aaagtgttta tcggttcctg taccaactcg cgcattgaag atttacgcgc ggcagcggag      1080
     atcgccaaag ggcgaaaagt cgcgccaggc gtgcaggcac tggtggttcc cggctctggc      1140
     ccggtaaaag cccaggcgga agcggaaggt ctggataaaa tctttattga agccggtttt      1200
     gaatggcgct tgcctggctg ctcaatgtgt ctggcgatga acaacgaccg tctgaatccg      1260
     ggcgaacgtt gtgcatccac cagcaaccgt aactttgaag gccgccaggg gcgcggcggg      1320
     cgcacgcatc tggtcagccc ggcaatggct gccgctgctg ctgtgaccgg acatttcgcc      1380
     gacattcgca acattaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page