(data stored in ACNUC7421 zone)

EMBL: CP000038.MRCB

CP000038.MRCB        Location/Qualifiers
FT   CDS_pept        178927..181461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SSON_0161"
FT                   /old_locus_tag="SSO_0161"
FT                   /product="peptidoglycan synthetase"
FT                   /note="penicillin-binding protein 1B; Code: M; COG:
FT                   COG0744"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86954"
FT                   /db_xref="GOA:Q3Z5K8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5K8"
FT                   /protein_id="AAZ86954.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDGELYEMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
     atggccggga atgaccgcga gccaattgga cgcaaaggga aaccgacgcg tccggtcaaa        60
     caaaaggtaa gccgtcgtcg ttacgaagat gacgatgatt acgacgatta tgatgactat       120
     gaggatgaag aaccgatgcc gcgcaaaggt aagggcaaag gcaaagggcg taagcctcgt       180
     ggcaaacgcg gctggctatg gctgctgtta aaactggcta tcgtttttgc cgtgctgatc       240
     gccatttacg gcgtttatct cgatcaaaaa attcgtagcc gtattgatgg caaggtctgg       300
     caactgcccg cggcagttta tggccgaatg gtcaaccttg aaccagatat gaccatcagc       360
     aagaacgaaa tggtgaagct gctggaggca acacagtatc gtcaggtgtc gaaaatgacc       420
     cgtcctggcg aatttaccgt gcaggccaac agcattgaga tgatccgccg tccgtttgat       480
     ttcccggaca gcaaagaagg gcaggtgcgt gcgcgtctga cctttgatgg cgatcatctg       540
     gcgacgatcg tcaatatgga gaacaaccgt cagttcggtt tcttccgtct tgatccgcgc       600
     ctgatcacca tgatctcttc gccaaacggt gagcagcgtc tgtttgtgcc gcgcagtggt       660
     ttcccggact tgctggtgga tactttgctg gcgacagaag accgtcattt ctacgagcat       720
     gatgggatca gtctctactc catcggacgt gcggtgctgg caaacctgac cgccggacgc       780
     acggtgcagg gagcgagtac gctgacgcaa cagctggtga aaaacctgtt cctctccagc       840
     gagcgttctt actggcgtaa agcgaacgaa gcttacatgg cgctgatcat ggacgcgcgt       900
     tacagcaaag accgtattct tgagctgtat atgaacgagg tgtatctcgg tcagagcggc       960
     gacaacgaaa tccgcggctt cccgcttgcg agcttgtatt actttggtcg cccggtagaa      1020
     gagctcagcc tcgaccagca ggcgctgtta gtcggtatgg tgaaaggggc gtccatctac      1080
     aacccgtggc gtaacccgaa actggcgctg gagcgacgta atctggtgct gcgtttgcta      1140
     caacaacagc agattatcga tggtgaactg tatgaaatgc tcagcgcgcg tcctctgggc      1200
     gtacagccgc gcggtggggt aatctctcca cagccagcct ttatgcaact ggtgcgtcag      1260
     gagctgcagg cgaaattagg cgataaggta aaagatctct ccggcgtgaa gatcttcact      1320
     acctttgact cggtggccca ggacgcggca gaaaaagccg ccgtggaagg cattccggca      1380
     ctgaagaaac agcgtaagtt gagcgatctt gaaactgcaa ttgtggtcgt cgaccgcttt      1440
     agtggtgaag ttcgtgcgat ggtgggaggt tctgagccgc agtttgcggg ctacaaccgt      1500
     gcgatgcagg cgcgtcgttc gattggttcc cttgcaaaac cagcgactta tctgacggct      1560
     ttaagccagc cgaaaatcta tcgcctgaac acgtggattg ccgatgcgcc aatcgcgctg      1620
     cgtcagccga atggccaggt ctggtcaccg cagaacgatg accgtcgtta tagcgaaagc      1680
     ggcagagtga tgctggtgga tgcgttgacc cgttcgatga acgtgccgac ggtaaatctg      1740
     gggatggcgc tggggctgcc tgcagttacg gagacctgga tcaaactggg cgtgccgaaa      1800
     gatcagctgc atccggttcc ggcgatgctg ctgggggcgt tgaacttaac gccaatcgaa      1860
     gtggcgcagg cattccagac catcgccagc ggcggtaacc gtgcaccgct ttctgcactg      1920
     cgttcggtaa tcgcggaaga tggcaaggtg ctgtatcaga gcttcccgca ggcagaacgc      1980
     gctgttccgg cgcaggcggc gtatctgaca ctatggacca tgcagcaggt ggtacaacgt      2040
     ggtacgggtc gtcaacttgg ggcgaaatac ccgaacctgc atctggcagg gaaaacaggg      2100
     actaccaaca ataacgtaga tacctggttt gcgggcattg acggcagcac ggtgaccatc      2160
     acctgggtag gccgtgataa caaccagccg accaaactgt atggtgccag cggggcaatg      2220
     tctatttatc agcgttatct ggctaaccag acgccaacgc cgctgaatct tgttccgcca      2280
     gaagatattg cagatatggg cgtggactac gacggcaact ttgtttgcag cggtggcatg      2340
     cgtgtcttgc cggtctggac cagcgatccg caatcgctgt gccagcagag cgagatgcag      2400
     cagcagccgt caggcaatcc gtttgatcag tcttctcagc cgcagcaaca gccgcaacag      2460
     caacctgctc agcaagagca gaaagacagc gacggtgtag ccggttggat caaggatatg      2520
     tttggtagta attaa                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page