(data stored in ACNUC7421 zone)

EMBL: CP000038.MURE

CP000038.MURE        Location/Qualifiers
FT   CDS_pept        102503..103996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SSON_0093"
FT                   /old_locus_tag="SSO_0093"
FT                   /product="meso-diaminopimelate-adding enzyme"
FT                   /note="Code: M; COG: COG0769"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86888"
FT                   /db_xref="GOA:Q3Z5S4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5S4"
FT                   /protein_id="AAZ86888.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFY
FT                   HEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGS
FT                   AVDVQHELAGLVEQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEH
FT                   YEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAIDV
FT                   NYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQP
FT                   VCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPL
FT                   MGAIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAK
FT                   ENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
     gtggcagatc gtaatttgcg cgaccttctt gctccgtggg tgccagacgc accttcgcga        60
     gcactgcgag agatgacact cgacagccgt gtggctgcgg cgggcgatct ctttgtagct       120
     gtagtaggtc atcaggcgga cgggcgtcga tatatcccgc aggcgatagc gcaaggtgtg       180
     gctgccatta ttgcagaggc gaaagcgaaa gatgaggcga ccgacggtga aatccgtgaa       240
     atgcacggcg taccggtcat ctatctcagc cagctcaatg agcgtttatc tgcactggcg       300
     ggccgctttt accatgaacc ctctgacaat ttacgtctcg taggcgtaac gggcaccaac       360
     ggcaaaacca cgactaccca gctgctggcg cagtggagcc aactgcttgg cgaaaccagc       420
     gcggtaatgg gcaccgttgg taacggtctg cttgggaaag tgatcccgac agaaaatact       480
     accggttccg cagtcgatgt tcagcatgag ctggcggggc tggtggagca gggcgcgacg       540
     ttttgcgcaa tggaagtttc ctcccacggg ctggtacagc accgtgtggc ggcattgaaa       600
     tttgcggcgt cggtctttac caacttaagc cgcgatcacc ttgattatca tggtgatatg       660
     gaacactacg aagctgcgaa atggctgctt tattctgaac atcattgcgg tcaggcgatt       720
     attaacgccg acgatgaagt gggccgccgc tggctggcaa aactgccgga cgcggttgcg       780
     gtatcaatgg aagatcatat taatccgaac tgtcacggac gctggttaaa agcgatcgac       840
     gtgaactatc acgacagcgg tgcgacgatt cgctttagct caagttgggg cgatggcgaa       900
     attgaaagcc atctgatggg cgcttttaac gtcagcaacc tgctgctcgc gctggcgaca       960
     ctgctggcac tcggctatcc actggctgat ctgctgaaaa ccgccgcgcg tctgcaaccg      1020
     gtttgcggac gtatggaagt gttcactgcg ccaggcaaac cgacggtggt ggtggattac      1080
     gcgcatacgc cggatgcact ggaaaaagcc ttacaggcgg cgcgcctgca ctgtgcgggc      1140
     aagctgtggt gcgtctttgg ctgtggtggc gatcgcgata aaggtaagcg tccactgatg      1200
     ggcgcaattg ccgaagagtt tgctgacgtg gcggtggtga cggacgataa cccgcgtacc      1260
     gaagaaccgc gtgccatcat caacgatatt ctggcgggaa tgttagatgc cggacatgcc      1320
     aaagtgatgg aaggccgtgc tgaagcggtg acttgcgccg ttatgcaggc taaagagaat      1380
     gatgtggtac tggtcgcggg caaaggccat gaagattacc agattgttgg caatcagcgt      1440
     ctggactact ccgatcgcgt cacggtggcg cgtctgctgg gggtgattgc atga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page